SecReT6
Protein ID: 451948299
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02705
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3016452..3016940 [-]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDM1PSA2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.10E-58, Aligned region: 5..158
Protein Sequence: 162 a.a.     [Download]
>gi|451948299|ref|YP_007468894.1| type VI secretion protein, VC_A0107 family [Desulfocapsa sulfexigens DSM 10523]
MAKEGSVAPKERVNIVYRPATGDAKEEVELPLKILIMGDFTQKDDERAVEDRDPINIDKDNFNDVMKEQD
LSLNMTVPNKLSDDPDEELAVKLAFESLKDFSPDAIAQNSPELKKLMELRQALTALKGPLSNVPEFRKKI
QSLVKDDESKDQLLKELGVEDK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3016940-3016452 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGCAAAGGAAGGTTCTGTTGCTCCTAAGGAGAGAGTCAATATTGTCTATCGTCCGGCAACCGGAGATG
CCAAGGAAGAGGTGGAACTTCCTCTAAAAATACTCATCATGGGAGATTTCACCCAAAAAGATGATGAGCG
TGCTGTTGAGGATCGAGACCCCATCAATATCGATAAAGACAACTTCAACGATGTCATGAAAGAGCAAGAC
CTCAGCTTGAACATGACGGTACCAAATAAATTATCGGATGATCCTGACGAAGAACTTGCTGTTAAACTGG
CATTTGAATCACTGAAAGATTTTTCCCCAGATGCCATAGCCCAAAACAGTCCTGAACTAAAAAAACTCAT
GGAACTTCGCCAGGCCCTGACCGCGTTAAAAGGACCTCTGTCAAATGTACCTGAATTTCGGAAGAAAATC
CAAAGCCTTGTGAAGGATGACGAGTCCAAAGATCAACTGCTGAAAGAACTCGGTGTCGAGGATAAATAG