SecReT6
Protein ID: 451948300
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02706
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3017105..3018685 [-]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDM1PC91
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.30E-18, Aligned region: 47..107
ImpA-rel_N [PF06812], Evalue: 5.30E-18, Aligned region: 337..348
Protein Sequence: 526 a.a.     [Download]
>gi|451948300|ref|YP_007468895.1| type VI secretion-associated protein, VC_A0119 family [Desulfocapsa sulfexigens DSM 10523]
MDILTIGTTPISDACPAGTDSRYEPAFEELQTEIDKIGSPSASEGVNWVRVSQLTEKILTEESKDLLVMS
YFAVSQIHTRELAGLTTGLQAYCDLLETFWDTMFPLKKRMRGRVAAAEWWIENSASALELLRLQSVEEES
KNTLLAHCDKLKQLFLELFPEPPSLNRLIRTIESLPIKKEKAISPPQKQVKEPEPKQQPPEQVEKKPIPT
PEPKVQETASSSEDPIVAIQTANERIKRAALTLIEQDLINPLGHRSLRTAIWSDIDVLPQAVEGKTIIPP
PEPHIVLMIQDLSSRGDWINLSSTAERQFPQYIFWLDLQRYCATSLENLGLPYQKAWEAVCQETAALLHR
LPGVHNLQFSDGTPFADEETKEWCQNLGSAGDGMDMGSSFSTAEGTTEEVNQLNNAIQRAGELLKERKLT
EALVLLQQGIMEAHSSRESMQWRLALIRILISGKKAEMALPHCEKLVEELEHHKLEIWDPTQALIVYKTF
YHCLKMISSKIVKERGRDLLDKIATLDSVEAIRISS
 
Nucleotide Sequence: 1581 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3018685-3017105 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGATATACTTACAATAGGAACAACTCCGATAAGTGATGCTTGTCCCGCCGGTACAGATAGCCGCTACG
AACCAGCCTTTGAAGAACTTCAAACTGAAATAGACAAAATTGGTTCTCCATCTGCCTCTGAGGGAGTTAA
CTGGGTGCGGGTAAGTCAACTTACCGAAAAGATATTAACAGAGGAGAGTAAAGATCTTTTGGTGATGAGT
TATTTTGCCGTTTCCCAAATTCACACCCGCGAGCTTGCAGGACTTACGACTGGATTGCAGGCTTATTGCG
ATTTGCTGGAAACGTTCTGGGACACAATGTTTCCCTTAAAAAAGAGAATGCGTGGCCGGGTGGCAGCTGC
AGAATGGTGGATTGAAAACAGTGCAAGTGCTCTTGAGCTTCTTCGTCTCCAATCCGTAGAAGAAGAAAGC
AAAAATACTCTTTTGGCACATTGCGATAAGCTTAAACAGCTTTTCCTTGAGCTGTTCCCTGAGCCCCCCT
CTTTAAATCGGTTGATAAGGACCATTGAATCTCTTCCAATTAAAAAAGAAAAAGCTATATCCCCTCCGCA
GAAGCAGGTAAAAGAGCCCGAACCGAAACAACAGCCACCTGAACAGGTGGAAAAAAAACCGATTCCTACC
CCGGAACCGAAAGTCCAGGAAACAGCTTCCTCAAGTGAAGACCCCATAGTCGCTATTCAGACAGCCAATG
AAAGAATCAAGCGGGCAGCTCTTACTCTGATAGAACAGGATCTTATCAATCCACTGGGGCATCGATCCCT
GCGGACAGCAATCTGGTCAGATATCGATGTGCTTCCCCAGGCAGTGGAAGGCAAAACAATTATACCGCCA
CCGGAACCTCATATCGTTCTGATGATACAAGACCTGTCCTCTCGAGGAGACTGGATCAATTTATCCTCAA
CTGCAGAAAGACAGTTTCCTCAATATATTTTCTGGCTGGATCTGCAGCGATACTGTGCCACCAGCCTCGA
AAACCTCGGTCTTCCATACCAAAAGGCCTGGGAGGCAGTATGCCAGGAAACGGCTGCCCTCCTTCACAGA
CTCCCCGGGGTACACAATCTCCAATTTTCAGACGGGACCCCCTTTGCTGATGAGGAGACAAAGGAATGGT
GTCAGAATCTTGGATCTGCAGGAGATGGCATGGACATGGGTTCCAGTTTTTCCACTGCTGAAGGGACGAC
AGAGGAGGTAAATCAGTTAAACAATGCCATCCAGCGTGCCGGAGAACTCTTAAAGGAACGAAAACTCACC
GAGGCTCTTGTGCTTCTTCAGCAAGGGATTATGGAAGCCCATTCTTCCAGAGAATCGATGCAATGGCGAC
TGGCTCTCATACGAATATTGATTAGCGGAAAAAAAGCCGAGATGGCTCTGCCGCATTGTGAGAAGCTCGT
CGAAGAGCTGGAGCACCATAAGCTGGAAATCTGGGACCCGACTCAGGCCTTGATAGTTTACAAAACCTTC
TATCACTGCCTGAAAATGATTTCGTCAAAAATTGTAAAAGAGCGTGGCAGGGATCTGCTTGATAAAATAG
CCACCCTCGACTCAGTAGAGGCAATCCGCATTTCATCCTAA