SecReT6
Protein ID: 451948302
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02708
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3022519..3023193 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDM1NI29
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.90E-39, Aligned region: 2..212
Protein Sequence: 224 a.a.     [Download]
>gi|451948302|ref|YP_007468897.1| type IV / VI secretion system protein, DotU family [Desulfocapsa sulfexigens DSM 10523]
MALVDCFVELIAYVTYFLNDTPNRPASLEKVKTDISHLIAKSQDSFHKSHLPQEDYDLSRFAVFAWIDEA
ILSSNWEEKSKWQGEQLQRTYYQTTDGGELFFDKLNQLTPQQGQVREVYYLCLALGFTGRYCNPGDEFLL
EQLKNSNLKLIGGTTDLRSFDQKTLFPDAYLQEGATPEKFNDSSRFPIGVVLGATVPVLLYGVLFFIYRF
VLDNVGENFISMVQ
 
Nucleotide Sequence: 675 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3023193-3022519 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGCACTTGTGGACTGTTTCGTAGAATTAATCGCTTATGTTACCTATTTTCTCAACGATACACCAAATC
GGCCCGCCTCACTTGAAAAGGTCAAAACCGACATCAGCCACCTGATCGCCAAAAGTCAGGATAGCTTTCA
CAAAAGCCATTTACCCCAGGAAGATTATGATCTTTCCCGTTTTGCAGTCTTTGCCTGGATCGATGAGGCC
ATTCTCAGCTCAAACTGGGAGGAAAAAAGTAAATGGCAGGGGGAACAGCTGCAGCGTACCTACTATCAAA
CCACCGATGGCGGTGAACTCTTCTTTGACAAGCTGAACCAGCTGACCCCACAACAGGGGCAGGTGCGTGA
AGTATACTACCTCTGTCTGGCTCTTGGATTCACTGGCCGCTACTGTAACCCTGGAGATGAGTTTCTTCTG
GAACAGCTTAAGAACTCCAATCTGAAACTTATAGGAGGGACAACAGATCTGCGATCATTTGACCAGAAAA
CGCTTTTTCCCGATGCTTACCTGCAGGAGGGAGCCACCCCTGAAAAATTTAATGATAGCAGTCGGTTTCC
AATTGGTGTGGTATTAGGTGCTACGGTTCCTGTGCTACTCTATGGCGTTCTTTTTTTCATTTATCGTTTT
GTCCTTGATAATGTCGGTGAAAACTTTATTTCCATGGTGCAGTAA