SecReT6
Protein ID: 451948303
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02709
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3023196..3024581 [-]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDM1PI19
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-100, Aligned region: 17..458
Protein Sequence: 461 a.a.     [Download]
>gi|451948303|ref|YP_007468898.1| type VI secretion protein, VC_A0114 family [Desulfocapsa sulfexigens DSM 10523]
MERPFFWHQGLFLQPQHFQLQDRYIQSMTMPLQTFLQPHFWGIGNLKIQDAALGNLSLQVLQGQFQFPDG
SFISFPENGLIAPRSFSEDWLEGDKPLGILLGLRKWNPGGENVTILSSLDNVSDVATRFVTTTEPEEVQD
LYQGGKSAQVKRLHYVLKIFWDSEEDQLGDYELIPLARILRQGEQIVRSNRFFPPCLSIKASEPLMGLVT
EIRDQLASRSHLLEAYKRERGVHTAEFGAQDTIFLLALRSLNRYIPLLFQITEAQTVHPWTVYGLLRQII
GELSSFSETINVLGEHENGTVLVPPYNHRKLHTCFLSAQNVLLRLLDEITAGPEYMLPLIYDGTYFSGEL
SKSMFDSHNRFYLVLATEQEPNQALQSFAGLAKIGSRETLPLLIARALPGVKVKHMETPPQELPRRRGSL
YFQIDHHGDLWQQVQHSNQLAIFWDEAPEDLKAELMVVGRR
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3024581-3023196 Desulfocapsa sulfexigens DSM 10523, complete genome
ATGGAACGACCTTTTTTCTGGCATCAGGGACTCTTTCTCCAACCCCAGCACTTTCAACTACAGGACCGTT
ATATCCAATCCATGACCATGCCCCTGCAGACTTTCCTGCAACCGCATTTCTGGGGTATCGGCAATCTTAA
AATCCAGGACGCAGCACTGGGTAACCTCTCCTTGCAAGTTCTCCAGGGACAGTTTCAATTTCCCGATGGC
AGCTTTATCTCTTTTCCTGAGAATGGACTGATTGCTCCCCGCTCATTCAGTGAGGATTGGCTGGAAGGCG
ACAAGCCACTTGGAATTCTTCTAGGACTGCGCAAATGGAATCCTGGTGGCGAGAATGTTACCATCCTCTC
CAGTCTTGATAATGTCAGCGATGTGGCCACCCGCTTTGTTACCACTACAGAGCCAGAAGAGGTGCAGGAT
CTCTATCAGGGTGGAAAAAGTGCCCAGGTTAAACGCCTCCATTACGTCTTGAAAATTTTCTGGGACAGTG
AAGAAGACCAGCTGGGAGACTATGAGTTGATTCCCCTTGCCCGTATTCTACGGCAGGGTGAGCAGATTGT
ACGCTCCAACCGTTTTTTCCCTCCTTGCCTCAGTATCAAGGCAAGCGAACCCCTTATGGGATTAGTTACT
GAAATCCGTGACCAGCTCGCCTCCAGATCCCATCTCCTTGAGGCCTACAAGCGTGAACGTGGTGTTCATA
CGGCAGAATTCGGTGCCCAAGATACAATCTTCCTTCTCGCCCTGCGTTCACTCAACCGATATATTCCTCT
CCTCTTTCAGATAACCGAAGCCCAGACTGTCCATCCCTGGACGGTATACGGTCTTCTGCGTCAAATCATC
GGTGAACTATCAAGTTTCTCTGAGACAATAAATGTACTTGGAGAACATGAAAACGGCACTGTTCTGGTTC
CGCCCTACAATCACCGTAAACTGCACACCTGCTTTCTGTCGGCGCAAAATGTCCTGCTGCGCCTACTGGA
TGAGATTACAGCCGGCCCCGAATACATGCTGCCGCTCATTTATGATGGTACGTATTTCAGCGGCGAACTC
TCAAAATCCATGTTTGATTCTCATAATCGTTTCTATCTCGTTCTGGCAACGGAACAGGAGCCCAATCAAG
CTCTGCAGAGCTTTGCCGGTCTGGCCAAGATAGGTTCGCGGGAAACTCTGCCGTTACTTATTGCCAGAGC
CCTGCCAGGAGTCAAAGTAAAACATATGGAGACACCACCGCAGGAGCTTCCCCGCAGGCGTGGTTCACTC
TATTTTCAAATTGATCATCATGGCGACCTCTGGCAACAGGTGCAGCACAGCAATCAGCTGGCAATTTTCT
GGGACGAAGCACCTGAAGATCTTAAGGCTGAACTTATGGTTGTTGGCAGGAGATAA