SecReT6
Protein ID: 451948304
SecReT6 ID735
T6SS typei1
Gene symbol-
Locus tagUWK_02710
StrainDesulfocapsa sulfexigens DSM 10523
Repliconchromosome [GenBank: NC_020304] [Browse all T6SS(s) in this replicon]
Location [Strand]3024592..3025122 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDM1PSA8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.50E-24, Aligned region: 14..165
Protein Sequence: 176 a.a.     [Download]
>gi|451948304|ref|YP_007468899.1| type VI secretion lipoprotein, VC_A0113 family [Desulfocapsa sulfexigens DSM 10523]
MKRYFTLIILLSSLVLLSSCGSKAPAPPPVPQWVYEKDSITMRIKADHLLNLNEGTPHTLMVGIYQLRNK
AMFEQLASNSDGIYQLLDCEPFDSSVTSVKRLFIQPEQDLTIVMDRLAGTKHIGLVAGYFVLQKERMVRT
INIPVIIDKSYKYAEAGKLNLIVNLGSEQIAAIQTH
 
Nucleotide Sequence: 531 bp     [Download]
>gi|451945650|ref|NC_020304.1|:c3025122-3024592 Desulfocapsa sulfexigens DSM 10523, complete genome
TTGAAACGATATTTCACCCTTATCATCCTTCTCTCCAGCCTTGTCCTGTTATCTTCCTGTGGCTCAAAAG
CCCCGGCACCTCCTCCGGTTCCGCAGTGGGTCTATGAAAAAGACAGCATCACCATGCGGATAAAGGCGGA
TCACCTGTTAAATCTGAACGAAGGTACTCCTCATACTCTAATGGTTGGTATATACCAGTTACGTAACAAG
GCCATGTTTGAGCAACTGGCTTCTAACAGCGACGGCATTTACCAACTGCTGGACTGTGAACCGTTTGACA
GCAGTGTTACTTCCGTCAAACGCCTTTTTATCCAGCCAGAACAGGATTTGACAATTGTCATGGATCGACT
TGCTGGGACAAAACATATTGGACTGGTAGCCGGTTACTTTGTATTACAGAAAGAAAGGATGGTACGAACC
ATCAACATCCCTGTTATTATAGACAAAAGCTATAAATATGCCGAAGCCGGCAAACTCAATCTGATCGTAA
ACCTGGGTTCCGAACAGATAGCTGCAATCCAAACGCACTGA