SecReT6
Protein ID: 45332447
SecReT6 ID791
T6SS typei4b
Gene symbolevpE
Locus tagEvpE
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]8320..8796 [+]
ProductEvpE
NoteTssE
UniProt IDQ6EE17, Q6EE17
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.70E-22, Aligned region: 35..141
Protein Sequence: 158 a.a.     [Download]
>gi|45332447|ref|AAS58123.1| EvpE [Edwardsiella tarda]
MILRHLFRPSVLDRLFDDFPQERTERTSDRRYDLAHFRWAVRRDVEDVLNTRSALSLDIDQWPELEKSPL
NYGLPDCSNLSAANAEDREWIRQHIERAIDLFEPRLSQVRVHIHLDEKTGISQLIFRIEALLDVDPSPEP
VMFDAVLDVSTQLYRIDR
 
Nucleotide Sequence: 477 bp     [Download]
>gi|158512110|gb|AY424360|evpE|:8320-8796
ATGATCCTTCGCCATCTCTTCCGCCCCTCCGTGCTGGATCGTCTGTTCGATGATTTCCCACAGGAGCGAA
CCGAACGGACATCAGACCGTCGGTATGACCTGGCCCACTTTCGCTGGGCCGTCCGACGGGATGTGGAGGA
TGTCCTGAATACGCGATCCGCGCTGTCGCTGGATATCGATCAGTGGCCTGAGCTGGAAAAGTCCCCCCTG
AATTACGGCCTGCCGGACTGCTCCAACCTGAGCGCCGCCAACGCCGAGGATCGGGAGTGGATCCGCCAGC
ATATCGAGCGGGCCATCGATCTGTTTGAACCCCGGCTGAGCCAGGTCCGGGTGCACATCCATCTGGATGA
GAAAACCGGCATCAGCCAGCTGATCTTCAGGATCGAGGCATTACTGGACGTCGATCCCTCGCCGGAGCCG
GTGATGTTCGATGCCGTGCTGGATGTTTCAACACAGCTGTACCGAATAGACAGGTGA