SecReT6
Protein ID: 45441182
SecReT6 ID56
T6SS typei2
Gene symbol-
Locus tagYP_1356
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]1485302..1485805 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ74VF4
KEGG IDypm:YP_1356
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.00E-56, Aligned region: 8..160
Protein Sequence: 167 a.a.     [Download]
>gi|45441182|ref|NP_992721.1| hypothetical protein YP_1356 [Yersinia pestis biovar Microtus str. 91001]
MMSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLA
EFQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRR
ELENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|45439865|ref|NC_005810.1|:1485302-1485805 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATA
CTGGCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCA
GGAGCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCT
GAATTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCG
CTTTGACCTTCCGCGAGATGAAAGATTTCGAACCGGAAAGCGTCGCCCGTCAAATCCCGCAACTGCGTGC
CTTGCTGGCCATGCGCAACCTGCTGCGAGACCTCAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGT
GAGCTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCAC
CAAAAGAGGGTTAA