SecReT6
Protein ID: 45441185
SecReT6 ID56
T6SS typei2
Gene symbol-
Locus tagYP_1359
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]1488753..1489439 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7CHN1
KEGG IDype:YPO0975, ypk:y3366, ypm:YP_1359, ypm:YP_3464, ype:YPO1468, ypk:y2703
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-47, Aligned region: 14..216
Protein Sequence: 228 a.a.     [Download]
>gi|45441185|ref|NP_992724.1| hypothetical protein YP_1359 [Yersinia pestis biovar Microtus str. 91001]
MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQRCVADIERVHQALKDAGHSEQSCQHI
RYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHFFNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLM
LGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWW
GLDHWLSGLLATLLPEPV
 
Nucleotide Sequence: 687 bp     [Download]
>gi|45439865|ref|NC_005810.1|:1488753-1489439 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGAATCCTCACCTAACCGAACACCCCCCAGTCGGGGATATTGACGCCCTGTTGCAGGACACCTGGCTAC
AGGTGATCAGCCTGCGTCAAGGGGTAACCTGTGCCGAGGGCGAAGGGCAGGCATTCTGGCAGCGCTGTGT
GGCGGACATTGAACGTGTCCATCAGGCGCTGAAAGACGCCGGTCACAGCGAGCAGAGTTGCCAGCACATC
CGATACGCCCAATGTGCACTGCTGGATGAGACCGTGAAAGGGCGCGGTGTACAGGATGATGCCTACTTCG
TGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGATGCCGGTAGCCAGCTTTACGAGCG
GATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGACCTGTTTTCACCGGGTATTGATG
TTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGAGCAACTGATCGATCAACTGAGCG
TGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCAAGCGCCGCCTCCCGCAACCGGTT
GGGGATCTGGTTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGCTGATGGTTGCGCTGTTGTGGTGG
GGCCTTGATCACTGGCTGTCCGGTCTGTTAGCCACCTTACTGCCGGAGCCGGTGTAA