SecReT6
Protein ID: 45441186
SecReT6 ID56
T6SS typei2
Gene symbolompA2
Locus tagYP_1360
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]1489439..1491175 [+]
Producthypothetical protein
NoteTagL
UniProt IDQ74VF0
KEGG IDypm:YP_1360, ype:YPO1469
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.50E-15, Aligned region: 447..543
Protein Sequence: 578 a.a.     [Download]
>gi|45441186|ref|NP_992725.1| hypothetical protein YP_1360 [Yersinia pestis biovar Microtus str. 91001]
MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICMLGGSRAGRQAAGASSDPLFAGLATEN
GLLPENSRLPVVLVCGDGLASWFGRERSHQSAQGCWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVN
PQQRRDERLLAADLQELRWQLMQLRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGS
LADWQRAESRAVQAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVAPLAPQQIIQQQVASLADPVPASLW
QHWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLAAMVALCSSAW
QNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLRRDAGLLDEGYRNGEPLRLGLGLYRGERLRPPLLAA
IKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAGSTKMLVTALIDIKAKPGWLIVVAGHTDITGDA
QANHILSLKRAEALRDWMLSTSDVSPTCFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQVPD
VKTASQDESDVSTQEMEK
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|45439865|ref|NC_005810.1|:1489439-1491175 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGAGTCGGTGGTGGCAACGTGGGTTGTGGCTCTGGGCGGGTTTGCTGGCGGTCATCTTGTGTCTGGCAT
TTCTGCCGCTCTCCCCGTGGGGGCGCTGGCTGATGCTGGCATGGGTGGTGCTGATTTGCATGCTGGGCGG
GTCGCGGGCAGGGCGGCAAGCGGCCGGTGCATCCTCTGATCCGCTGTTCGCCGGGTTGGCAACTGAAAAC
GGTCTTCTGCCTGAAAACAGTCGCTTACCGGTGGTGTTGGTATGTGGTGATGGTCTGGCGTCATGGTTTG
GTCGCGAACGGTCACACCAGAGTGCACAGGGCTGCTGGCTGCGGGTGGATGATATCAGCACCCTGCGGCA
GTTTGCCCGACAACTGCTGTGGCAACGGCCGGAATGGGCCGCTCAGTTGGCGGTGATGATGGTCGTGAAC
CCGCAGCAACGCCGCGATGAGCGCCTGCTGGCCGCCGATCTGCAAGAGCTGCGCTGGCAACTGATGCAAC
TGCGCCGCGATAGCCGCCATCCTGTTCCCTTGCTCCTGAGCAGCACGGTGGCCACCTCGGTTGCCCGTGA
TACGGTCTGGCTGTCACAGCAGCAGACACCGCCGCTGACACTCTGGTCAACCGTCTCGACGCCGGGCTCT
CTGGCCGACTGGCAGCGTGCGGAAAGCCGTGCCGTACAGGCCGAACGACTGAAACAGGCGGTGCTGTTCA
GCAGCCAGCATGACTGGCTGAACGCACAGGTGCTGCCGGTATTGCAGGCACCCAATGCGGATGTTGCCCC
CCTTGCCCCGCAACAGATTATTCAACAGCAGGTTGCCAGTCTGGCCGATCCGGTGCCTGCCTCGCTGTGG
CAGCACTGGCTGGCGGCGCATACCACGCTGACACAGGTGGCGGGTTGGCATCCACCGCCGCCCGCCGCCC
ATGACGCCTTACCGCTGCCGGATTTTGTCTTTTCAGCGCTTCCTCTTGGTAGCGGGGTGTCGTCACGCCG
TCGGGTACTGCGCCATGGTGTCACCTTACTGACGTTGGCGGCGATGGTGGCGTTGTGCAGCAGCGCCTGG
CAGAACCGGCAACTGTTGCACCGGGTGGCCTTTGATATCCGTCAGTACCACAGCGTGGCGATGACGGATT
ATTCCCCGAAAGCGCAGGCGGTGGCGGTATTACGCCGTGATGCGGGGCTGCTTGATGAAGGGTACCGCAA
CGGTGAACCGCTGCGTCTGGGCCTGGGGTTATATCGGGGGGAGCGGCTGCGCCCGCCGCTGTTGGCGGCG
ATCAAAAGCTACATCCCGCCCCCTCCGCCCCCTCCCGCGCCACCGGCGCCGAAAACCGTGCGCCTCGACA
GCCTGTCACTGTTCGATGTGGGTAAATTCACGCTGAATGCGGGGTCCACCAAAATGCTGGTCACGGCGCT
GATCGACATCAAAGCCAAACCCGGCTGGCTGATCGTGGTGGCCGGGCATACCGACATCACCGGCGATGCG
CAGGCCAACCACATTCTGTCGCTTAAGCGCGCCGAAGCATTACGCGACTGGATGCTGTCAACCAGCGACG
TCTCGCCGACCTGCTTTGCGGTGCAAGGTTACGGGGCCACACGCCCTATCGCCGACAACGATACTCCCGA
CGGTCGGGCGCTCAACCGCCGGGTCGAAATCAGTCTGGTACCACAGGCTGATGCCTGTCAGGTGCCGGAT
GTAAAAACAGCGTCACAGGATGAAAGTGACGTATCAACGCAAGAAATGGAGAAGTAA