SecReT6
Protein ID: 45441198
SecReT6 ID56
T6SS typei2
Gene symbol-
Locus tagYP_1373
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]1511844..1512929 [+]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.40E-28, Aligned region: 203..312
PAAR_motif [PF05488], Evalue: 3.70E-10, Aligned region: 19..74
Protein Sequence: 361 a.a.     [Download]
>gi|45441198|ref|NP_992737.1| hypothetical protein YP_1373 [Yersinia pestis biovar Microtus str. 91001]
MRITEKEQTMAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVN
GRKFAGTLNSQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHID
GALVVASYILDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVK
SGAKWDHKPKIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLG
STLEQVRTSIGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNND
NSSQIDHPQGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|45439865|ref|NC_005810.1|:1511844-1512929 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGCGGATAACAGAGAAGGAACAGACAATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCT
GCGGCGGCGTGATCATCGAAGGTGACGCCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGA
CAGAGTGACCTGCGGTAAACATCCGGGAACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAAT
GGCCGCAAGTTTGCGGGCACCTTGAATAGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTT
TGGTGCATGATACGTATGAGTTTGGTGCAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGT
CGAACGTGAGATGGTAGAAAATGTGAGTGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGAT
GGCGCTTTAGTAGTAGCGAGTTATATCCTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATA
AAATCAGATCTTTTATCGATAATGACCTCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTA
CGCGAGAATGAATGCACCTCCACAGCCTGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAG
AGTGGTGCTAAATGGGATCATAAACCTAAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTC
TGGTCGGAAGCGGAACCCGATCAAAAAGCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGT
CTGGTCCAATATTCACTATGGTTATGTAGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGC
TCAACTCTTGAGCAAGTAAGAACCAGCATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGA
AAATTGGCTATGCACTCTATCATCAACATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGA
TGCTCTTGAATCAGCATCGGACCTTGATCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGAT
AATTCGAGTCAAATTGATCACCCGCAGGGTAAGTAA