SecReT6
Protein ID: 45441202
SecReT6 ID56
T6SS typei2
Gene symbol-
Locus tagYP_1377
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]1516407..1516988 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ8CKX3
KEGG IDypm:YP_1377, ypk:y2682
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 31..186
Protein Sequence: 193 a.a.     [Download]
>gi|45441202|ref|NP_992741.1| hypothetical protein YP_1377 [Yersinia pestis biovar Microtus str. 91001]
MLTTVWKNKTCTSKHKSWAAWKNKICIPALVLLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTARE
ALNTDAHEANSSSEPVMVRVYQLRDDKTFLKTVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPME
KETQFVAVVALFRHPDMAKDHWRLILTLDDLHPDKPRTLELGNNSLTLRTEKK
 
Nucleotide Sequence: 582 bp     [Download]
>gi|45439865|ref|NC_005810.1|:1516407-1516988 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
GTGTTAACTACCGTTTGGAAAAATAAAACCTGTACTTCGAAACATAAAAGCTGGGCCGCCTGGAAAAATA
AAATCTGCATCCCCGCACTGGTCTTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCAC
CGTGTCGGCCACAAAATCACTGTTTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAA
GCCCTGAATACCGATGCGCACGAGGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTAC
GTGATGATAAAACCTTCCTCAAAACGGTGTATCAACAACTGGCAAGCGACGGGGAGGCGGCGCTTAAAGA
TGACCTGCTGGCCAGCCGCAGTGTGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAA
AAAGAGACCCAGTTTGTGGCAGTGGTGGCGCTGTTCCGTCATCCGGATATGGCCAAAGACCACTGGCGTC
TGATACTCACGCTGGACGACCTGCATCCCGATAAGCCCCGTACCCTTGAGTTGGGTAATAACAGCCTGAC
CCTGCGGACGGAGAAAAAATAA