SecReT6
Protein ID: 45441204
SecReT6 ID56
T6SS typei2
Gene symbol-
Locus tagYP_1379
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]1517465..1518832 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ7CHP2
KEGG IDype:YPO1489, ypk:y2679, ypm:YP_1379
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 116..150
DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|45441204|ref|NP_992743.1| hypothetical protein YP_1379 [Yersinia pestis biovar Microtus str. 91001]
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQTAVDFTLART
HTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLSDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIA
ELKKQASDVEWARLAEPVLQASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRA
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|45439865|ref|NC_005810.1|:1517465-1518832 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGGCAGGTAATACCGAGCGTCTGCTGAAAACCGGTGGCGATCCGCGCGCACTGGCGGATTTCACCGCAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGCCCGGATGTTGATTGGGTGCGAGTCGAGCAGCT
TTGTTTGGCGCTGTTTCGCCAGAACGGCGTTGAGTTACAGACTGCCGTTGATTTTACCCTGGCACGAACG
CACACCGTTGGGTTGGCGGGCTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGC
GTGGGTTATGGCCACCGCAAACGCATGCCCGGGTGGCGTTACTGGCCTGGTTGAGCGACCGGCTGCAGCA
AGTGTGGCGCACCATGACGCTGTGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTACTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGATACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
TGCAGTTAGATCAACTAACACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCGACCAATCAAGAGGTCAAACGACTGAATGCGTTGTGGCAGCAACAGCGAGCA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTCTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAATTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA