SecReT6
Protein ID: 45442527
SecReT6 ID57
T6SS typei3
Gene symbol-
Locus tagYP_2757
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]3063217..3063762 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ8CLE1
KEGG IDypm:YP_2757, ypk:y1545
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-59, Aligned region: 18..171
Protein Sequence: 181 a.a.     [Download]
>gi|45442527|ref|NP_994066.1| hypothetical protein YP_2757 [Yersinia pestis biovar Microtus str. 91001]
MFEIKAYMVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLL
DIDIDNFDERMKAMKPRVAFAVLNTLTGEGQLMVDITFESMDDFSPDAIAKKVDSLSQLLDARTQLANLQ
TYMDGKAGAEELVMKLLKDKSLLTTLASAPKAKQSAVDTPQ
 
Nucleotide Sequence: 546 bp     [Download]
>gi|45439865|ref|NC_005810.1|:3063217-3063762 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGTTTGAAATTAAGGCATATATGGTTAGCAAAAGTAATTCTCAAAAGTTTATCGCTCGAAACCGAGCGC
CACGCGTGCAGATTGAATACGATGTGGAAATATACGGTAGTGAAAAGAAGGTTGAATTACCTTTCGTTAT
GGGGGTATTAGCAGATTTATCCGGTAAACCTCTTGAGCCTTTACCTTCAGTCGCTGACAGAAAACTGTTA
GATATCGATATTGATAATTTCGATGAGCGCATGAAAGCAATGAAACCACGTGTTGCATTCGCCGTGCTGA
ATACATTGACTGGGGAAGGCCAGTTAATGGTCGATATTACGTTTGAGAGTATGGATGATTTCTCTCCTGA
CGCTATCGCGAAAAAAGTTGATTCATTGTCTCAATTATTAGATGCCCGAACTCAACTTGCCAACTTGCAG
ACTTATATGGATGGTAAGGCTGGTGCTGAGGAATTAGTTATGAAATTGCTGAAAGACAAATCATTACTGA
CAACGCTTGCATCCGCACCGAAAGCAAAACAATCCGCTGTTGATACTCCACAGTAA