SecReT6
Protein ID: 45442528
SecReT6 ID57
T6SS typei3
Gene symbol-
Locus tagYP_2758
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]3063765..3065288 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ8D0V3
KEGG IDypm:YP_2758, ypk:y1546
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.10E-194, Aligned region: 75..501
Protein Sequence: 507 a.a.     [Download]
>gi|45442528|ref|NP_994067.1| hypothetical protein YP_2758 [Yersinia pestis biovar Microtus str. 91001]
MIKKRKTMSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDA
YKSIASIIAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRY
KGVAWDQSPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQ
MESWQELSNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGA
DHSKYVWSNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRRE
AELAKNGFIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKI
GSFKERDEMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGL
TVSLRMVAKLPSLKDVA
 
Nucleotide Sequence: 1524 bp     [Download]
>gi|45439865|ref|NC_005810.1|:3063765-3065288 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGATTAAGAAGAGAAAAACGATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGA
CGGAATATAGCGATTTTAATACATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAAACGATAGCCGC
AGTAGAAGGTGCCGTTAAAACGTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCT
TATAAAAGTATTGCTTCCATTATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAACTTAATTTTGC
ACCACCAAGAATTCCAGTCTCTGGAAAGCGCATGGCGTGGGCTGCACTATTTAGTCAATAACACCGAGAC
TGATGAGAAGTTGAGATTACGTTTCCTCGACATTTCTAAAGATGAATTACGCCGTAACATGAAGCGTTAT
AAAGGTGTTGCTTGGGATCAAAGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAATTGGGTG
GCGAACCATACGGTTGCCTGGTAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGC
TTCAATTGGCAAAGTTGCCGCTTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAA
ATGGAATCTTGGCAAGAACTGTCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATG
CCGCATGGAACTCACTGCGTCAGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTC
GCGTCTGCCTTATGGGATTAACACCAATCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGATGGCGCG
GATCACAGCAAATATGTGTGGTCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAG
AGTATGGCTGGTGTACGCTGATTCGTGGTGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATAC
CTTCCCGACGGATGACGGCGGTATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAA
GCGGAACTGGCCAAGAATGGCTTTATTCCACTGGTTCACAGAAAGAATACGGATTACGCGGCATTCATTG
GCGCGCAGTCCCTGCAAAAACCTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGC
TCGTCTGCCATACCTGTTTGCTTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATC
GGCTCTTTTAAAGAGCGTGATGAGATGCAACGTTGGTTGAATGATTGGGTGATGAACTATGTTGATGGTG
ACCCAGCTAACTCTTCCCTGGAAACTAAAGCGCGCCGTCCTTTAGCCGCCGCTGAAGTGATTGTTGAAGA
AGTTGAAGGTAACCCTGGTTACTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTG
ACAGTATCCCTGCGTATGGTTGCTAAACTGCCTTCGCTGAAAGACGTAGCATAA