SecReT6
Protein ID: 45442529
SecReT6 ID57
T6SS typei3
Gene symbol-
Locus tagYP_2759
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]3065530..3066099 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ8CLE0
KEGG IDypk:y1547, ypm:YP_2759
PDB ID3V4H
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.30E-43, Aligned region: 34..164
Protein Sequence: 189 a.a.     [Download]
>gi|45442529|ref|NP_994068.1| hypothetical protein YP_2759 [Yersinia pestis biovar Microtus str. 91001]
MCLRIHMGSSYTRCFALSDIYKSAREDIMAQDMFIKIDGIEGESLDANHKNEIQVLAWNWDVAQHSNMHS
GSGGGSGKASVSDFCFAHYIDKASPNLLSYCLLGKHIKNVQFVLRKAGGDPLEYLTIKFTDVIITRVDMA
GSLEDETRPREEIRFSFTKMTQDYVMQNAEGHKSGVISANYDVKANMHS
 
Nucleotide Sequence: 570 bp     [Download]
>gi|45439865|ref|NC_005810.1|:3065530-3066099 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGTGCCTCCGTATTCATATGGGGTCTTCCTACACTCGATGTTTTGCATTGAGTGACATTTATAAAAGTG
CTAGAGAGGATATTATGGCGCAAGATATGTTTATCAAAATTGATGGTATTGAAGGTGAGTCTTTGGATGC
CAATCACAAAAACGAAATCCAGGTATTAGCTTGGAACTGGGATGTTGCTCAACACTCGAATATGCACAGC
GGTTCAGGTGGCGGTTCAGGTAAAGCCTCTGTTTCAGATTTTTGCTTCGCACATTATATCGATAAAGCTA
GCCCGAACTTATTGAGCTATTGCTTGTTGGGTAAGCACATTAAAAATGTTCAGTTCGTACTGCGTAAAGC
TGGTGGCGATCCGCTGGAATATCTGACAATTAAATTTACCGATGTCATCATTACTCGTGTTGATATGGCG
GGTTCTTTGGAAGATGAAACGCGTCCACGTGAAGAAATTCGTTTCTCATTCACTAAGATGACTCAGGACT
ATGTTATGCAGAATGCTGAAGGCCATAAGTCTGGCGTTATTTCTGCTAACTACGATGTTAAAGCTAACAT
GCACAGCTAA