SecReT6
Protein ID: 45442530
SecReT6 ID57
T6SS typei3
Gene symbol-
Locus tagYP_2760
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]3066313..3066912 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ8CLD9
KEGG IDypk:y1548, ypm:YP_2760
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.00E-36, Aligned region: 42..192
Protein Sequence: 199 a.a.     [Download]
>gi|45442530|ref|NP_994069.1| hypothetical protein YP_2760 [Yersinia pestis biovar Microtus str. 91001]
MWIRLNVFLIRLSMILIRLSMNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADIN
PNDKGVANPLRIALYTLKSTDEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAI
GIVAAYREIEQAEWKAVIYPLPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 600 bp     [Download]
>gi|45439865|ref|NC_005810.1|:3066313-3066912 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGTGGATAAGGCTTAACGTTTTTTTAATTAGGCTAAGTATGATTTTAATTAGGCTAAGTATGAATAAAA
GTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGACGATAGCCTG
TAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTACCGTCGAAATCGCGACAGCAGCGGATATTAAT
CCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCACTTTATACACTCAAGAGCACCGATGAATTTC
AGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGGATAACGTGTT
TGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGTTACTGCTATC
GGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCGTTGCCCAAAA
AACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCATGAAGGTACG
CGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA