SecReT6
Protein ID: 45443203
SecReT6 ID58
T6SS typei2
Gene symbol-
Locus tagYP_3461
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]3932824..3933327 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ74QK5
KEGG IDypm:YP_3461
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-55, Aligned region: 8..160
Protein Sequence: 167 a.a.     [Download]
>gi|45443203|ref|NP_994742.1| hypothetical protein YP_3461 [Yersinia pestis biovar Microtus str. 91001]
MMSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLA
EFQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFGR
ELENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 504 bp     [Download]
>gi|45439865|ref|NC_005810.1|:3932824-3933327 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
TTGATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATA
CTGGCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCA
GGAGCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCT
GAATTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCT
CCCTGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGC
CTTGCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCGGCCGT
GAGCTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGC
CAAAAGAGGGTTAA