SecReT6
Protein ID: 45443210
SecReT6 ID58
T6SS typei2
Gene symbolvgrG4
Locus tagYP_3468
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]3942261..3944609 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ74QJ8
KEGG IDypm:YP_3468
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.50E-65, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 1.20E-48, Aligned region: 582..598
DUF2345 [PF10106], Evalue: 1.20E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 2.90E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 2.90E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 1.90E-16, Aligned region: 393..481
Protein Sequence: 782 a.a.     [Download]
>gi|45443210|ref|NP_994749.1| hypothetical protein YP_3468 [Yersinia pestis biovar Microtus str. 91001]
MNTTLPTLRFDHSHHKLVVHDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRQEKANKPEDFPSVAP
ETTEPTSHFTFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|45439865|ref|NC_005810.1|:3942261-3944609 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCACGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCGACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGGGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAGTTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCAAGGTTACGAAAGCCTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTCTGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAAGGGATTTTCATCAGCGCTGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGACCAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAACCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGACAGGAAAAGGCAAATAAACCAGAAGATTTTCCGAGTGTTGCCCCG
GAAACAACAGAACCCACCAGTCATTTCACTTTTTCCTGA