SecReT6
Protein ID: 45443672
SecReT6 ID60
T6SS typeN/A
Gene symbolvgrG7
Locus tagYP_3944
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4486328..4488730 [-]
ProductRhs accessory genetic element
NoteTssI
UniProt IDQ7CL31
KEGG IDypm:YP_3944, ype:YPO3606, ypk:y0268
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 194..491
Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 670..701
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 531..623
Protein Sequence: 800 a.a.     [Download]
>gi|45443672|ref|NP_995211.1| Rhs accessory genetic element [Yersinia pestis biovar Microtus str. 91001]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVT
PMNLAAGGAGAGLPDSAAAAISRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASAD
PAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQAS
VEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDV
GSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEH
FDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGIQHSGK
QMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWD
RYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKT
QMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSN
TIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNA
GITITHDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2403 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4488730-4486328 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCAAAAACCGCCCTGGATGCC
AAAGCAAAAGTACTGGACGGCGGCGTCACGCCGACGAACATTGTGGCCACTGGCCCGGCCCCAACCGTGA
GTGGCGCTCAAATGACCGAGATGGCCGGGGGGATCGGGGATGCGGTGGGCGGTACTGCCGGTAAGCGCAT
TAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGAGGCCAAAGCAAAAGTACTGGACGGCGGCGTCACG
CCGATGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGCCGGACAGCGCCGCGGCGGCGATATCCCGCC
TGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTGCGGT
GGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGCCGAT
CCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTACTGC
AACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCTACAG
CATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAAGCCTCG
GTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCTTTTGGTTTTCGCCACC
CGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGACGGC
AGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGATGTT
GGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTGAGTA
TCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAA
CCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCAT
TTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGC
TGCGCAATGACGCCAATCTGGGGCAGGGGGCCAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGTTCAG
CCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGTATTCAGCACAGCGGCAAA
CAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTTATTC
CGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACCGGCGATGGACGGCCCGCAGATCGCCATGGT
GGTGGGGCCGCCGGGGGAAGAGATTTACTGCGACGAATACGGCCGCATCCGCCTGCAATTTTTATGGGAT
CGCTACGGGCAGAGCAATGACAACAGCTCCTGTTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAGGGCT
GGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGGATCA
ACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAAAACC
CAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCCAAAG
GCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGACGACCATGGTGCTGAATGATCGCAAAACCGA
TGTGACTCAGGACCATTCAGAGCACATTGGGCAAGATCAGTCCGTGACGGTTGTGCGTAACCAAAGTAAT
ACGATCCAAAATGATCGCCGGGTAGAGGTGACTCGCGATCAACAAACCGAAGTGGGCAATGATTACCAGC
TAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAATTCGTTACACCGAAGTGCATGAAGACGAAAC
GCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAAGGTGATATCAGCATATCAACCCCGAATGCC
GGAATTACGATCACCCATGACGGTGCCATTGTTCTGCAAGGGAAATACATTCGTTTAGCGGCCGATATGA
TCGATCTTAATCCAGAGGAGTAG