SecReT6
Protein ID: 45443673
SecReT6 ID60
T6SS typeN/A
Gene symbol-
Locus tagYP_3945
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4488752..4489285 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ74PG2
KEGG IDype:YPO3605, ypm:YP_3945
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.10E-48, Aligned region: 24..171
Protein Sequence: 177 a.a.     [Download]
>gi|45443673|ref|NP_995212.1| hypothetical protein YP_3945 [Yersinia pestis biovar Microtus str. 91001]
MTVLATQPESAALLWLNRPDVATYGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARL
VEARIGLAGTDSSYFQLQQRLHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVS
ADEHQPASPVLIKQIDDRWNALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 534 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4489285-4488752 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAACCGCCCGGATGTCGCCACCT
ATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTCAATACCGCCGACCAGTCGGT
GGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAAGCCAGCGCTGGGCGCGGTTG
GTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCTCCAGCAGCGCTTGCATGCGC
TGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACCATCTCCTATCTAAAAACAGCAGT
TTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTACTGCGCCAGTTGGCGGTGTCC
GCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGACCGCTGGAATGCCTTACTCA
GCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA