SecReT6
Protein ID: 45443676
SecReT6 ID60
T6SS typeN/A
Gene symbol-
Locus tagYP_3948
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4493754..4495160 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ74PF9
KEGG IDypm:YP_3948
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.50E-16, Aligned region: 59..118
Protein Sequence: 468 a.a.     [Download]
>gi|45443676|ref|NP_995215.1| hypothetical protein YP_3948 [Yersinia pestis biovar Microtus str. 91001]
MSLVRHMDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGSLAHATLNIDDIQQQAMALL
SQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLFWTTAWPQNPLHKRRFAQQILKRFDSASSSF
SQRADEAQRENVQGLLAHLAQVWHSREPGLAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAAT
PVSPSLAIDNTSDRAWRQTLLKMADLLSEQQPDAAIGFRLRRHAVWGSLTAPPMAQSDGRTPLAAVSADR
TADYLARLANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPALKTLF
FTDMTPFLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQQSEPRDRFYHQLLSA
QLFEKAGLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQRQLKP
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4495160-4493754 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGTCATTGGTGAGGCATATGGATATCACGTCACAACATCCCTGGCATGTCTTGTTACAAGCCCCTTTGT
CACCTGAGCAGACCGCACAAGCCCTGGCCGATGATGACCCCCAATGGGAATATATCGACGGCCAGATGGT
GAAACTGGGGTCATTGGCCCACGCCACGCTGAATATTGATGATATTCAGCAACAAGCCATGGCGCTGTTA
TCACAGAAAAGTAAAGACTTCCGGCTCGTGGTGCATCTACTGCGCACCCTACAACACGGGGGCCAGCCAG
ATGAATTAATGCTGGCGATGTCGTTGCTGACCGAATACGTCCAGCTATTTTGGACTACGGCCTGGCCGCA
AAATCCTTTACACAAACGGCGCTTTGCTCAACAAATCCTAAAACGCTTTGACAGCGCCAGCAGCAGTTTT
AGCCAACGAGCGGACGAGGCTCAACGTGAGAATGTGCAAGGATTATTGGCACATTTAGCACAGGTTTGGC
ATAGCCGTGAGCCGGGTCTGGCTAAAGAGGTGGATGCATTACGCAGCCGCTATGCGCGGCCACCGGAGCG
GGTTATCGAGGCAGTGGCTTCTGATGAACCGCTCTCATCCAACACCTTGGCGGCGGCAATGGCCGCCACC
CCCGTTAGCCCAAGCCTCGCCATAGATAACACGAGCGACAGAGCCTGGCGGCAGACCTTGCTGAAAATGG
CGGATCTACTCAGCGAACAGCAACCCGATGCCGCTATCGGTTTCCGGCTACGCCGCCATGCCGTATGGGG
CTCGTTAACCGCACCACCTATGGCGCAGAGCGATGGCCGCACCCCGTTAGCCGCGGTATCTGCGGATCGA
ACCGCCGATTACTTAGCACGTCTGGCTAATGCCGATTTGCCTTTGTGGCACCAAGTGGAGCAGAGCCTCA
CCCTCGCGCCTTATTGGCTGGATGGACATGTGCTTTCGGCACAAATCGCCCTGCAACTGGGTTATGACGC
GGTGGCACAGGCTATCCGTGATGAACTCAGCGTTTTTTTAGCCCGTATTCCCGCATTAAAAACCCTCTTT
TTTACGGATATGACGCCATTCCTCTCCTCTGAATCTGCCGCCTGGTTACAGCAGGATGCGAATCATCAGG
GAAGAAGTCGCACTATTGAACAGGATGAAATTTGGCAATGCTATCAACAGCAAGGATTGGAAGCCGCACT
ACAGATGATAAACCGGCAACCACAGCAATCCGAACCTCGGGACCGTTTTTACCATCAATTGCTCAGTGCA
CAGTTGTTCGAAAAAGCAGGGTTAACCGCATTGGCGCAGCAGCACTACCACAGCTTATTACTGGTAGGGC
AGCAATTACAGCTAAGCGAATGGGAACCTGCGTTGATCGCTCTACTGACAGAAAAACAGCGACAACTCAA
ACCATGA