SecReT6
Protein ID: 45443680
SecReT6 ID60
T6SS typeN/A
Gene symbol-
Locus tagYP_3952
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4499239..4500006 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ7CL28
KEGG IDype:YPO3598, ypm:YP_3952, ypk:y0276
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-63, Aligned region: 34..239
Protein Sequence: 255 a.a.     [Download]
>gi|45443680|ref|NP_995219.1| hypothetical protein YP_3952 [Yersinia pestis biovar Microtus str. 91001]
MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLGMVLRLKDMENQALPDQLYQQVVTDI
RAIEQYLQTKGYEPGAIISFRYVLCTFIDETALGHGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLM
GEPKRYQDLLEFIYLCFCLGYRGRYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYH
LSKRLTIKHLLWGGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS
 
Nucleotide Sequence: 768 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4500006-4499239 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGAAAACAGATGCTGTGACTGACAACACCCCTTTCCCCGCAGCGGAAGCGGTCACCTCCCATCGGCAGT
ATCAGCTACCGCTACGTGGCGAAAGCTTGAACGCGATGATCGATACCGCCACCCCATTATTGGGGATGGT
ACTGCGCCTGAAAGACATGGAAAACCAAGCGTTACCGGACCAGCTATATCAGCAGGTGGTGACGGATATC
CGTGCTATTGAGCAGTACTTGCAAACCAAAGGCTACGAACCCGGCGCAATCATATCTTTCCGATATGTGC
TGTGCACATTCATCGATGAAACGGCATTAGGGCATGGCTGGAACACCCAAAACGGTTGGTTACAGCAATC
TCTGTTGGTGCATTTTCATAATGAAACCTGGGGCGGAGAGAAAGTGTACGTCCTGCTGGAACGCTTAATG
GGGGAACCCAAGCGTTACCAAGACCTGCTGGAGTTTATCTATCTCTGTTTTTGTTTGGGTTACCGCGGCC
GCTACAAAGTGACATCACAAAACGGTGATGACTTTGAGCGATTGTTCCGCCGATTGCATCATCAATTACA
GCAGTTACGGGGTGATGCGCCGCCGACGGTCCTTTATCAAGGGGGCGGTCGTCTGAATAGCCGCTACCAC
TTGAGTAAACGGTTGACTATCAAGCATTTGTTATGGGGTGGCGTGAGTCTGCTGGTGGTGATTTATCTGT
TTTATGCCATCCACCTGCACACCCAAAGTCAGGATATTTTGCAACAGCTAAACAATTTATTGAGCTAG