SecReT6
Protein ID: 45443684
SecReT6 ID60
T6SS typeN/A
Gene symbol-
Locus tagYP_3956
StrainYersinia pestis biovar Microtus str. 91001
Repliconchromosome [GenBank: NC_005810] [Browse all T6SS(s) in this replicon]
Location [Strand]4503342..4504439 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ8CLT0
KEGG IDypm:YP_3956, ypk:y0280
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-93, Aligned region: 41..351
Protein Sequence: 365 a.a.     [Download]
>gi|45443684|ref|NP_995223.1| hypothetical protein YP_3956 [Yersinia pestis biovar Microtus str. 91001]
MLRMAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPA
NEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMN
VFNHRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRA
PEVICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGK
FLLCINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSIL
GDPEQKPSVTIGVME
 
Nucleotide Sequence: 1098 bp     [Download]
>gi|45439865|ref|NC_005810.1|:c4504439-4503342 Yersinia pestis biovar Microtus str. 91001 chromosome, complete genome
ATGTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGG
TTGAGAATGTAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTT
TCAATTGGTCGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCC
AATGAAGCCATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACA
CCTCCGCCCGAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACC
AGGATATTACCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGCTAACGGATTTCATGAAC
GTATTCAACCACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTG
ACAATGGCGGTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCG
CAATAAATTGCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCA
CCTGAAGTGATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGC
TACGCAAAGTGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAA
ATATGATGAAAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAA
TTCTTGTTGTGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACG
CCTCGTTAGTGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGC
CGAGCAACAGGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTC
GGCGATCCCGAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA