SecReT6
Protein ID: 470153450
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0962
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1064757..1065260 [+]
ProductType VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDK4FQL1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.40E-57, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|470153450|ref|YP_006281952.1| Type VI secretion protein, VC_A0107 family [Pectobacterium sp. SCC3193]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMIVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEESQDDLPVKLSIAGLNDFSPDRIAQQVPELRKLLDLREALVALKGPLGNIPSFR
NRLQDLLSSEEAREQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1064757-1065260 Pectobacterium sp. SCC3193, complete genome
ATGGCAAAAGGAACTGATGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTTCCGGCCA
CTGGTGGTCAGCAGGCGGAAATAGAATTGCCGTTGACGCTGATGATCGTGGGAAATATGAAAGGGCGCAC
AGAGGAAACGCCGATCGAAGAACGTCAGACCGTATCGATCGATAAGAACAATTTTACCTCCGTGATGAAA
GAAGCCAATCTGGAACTGAATTTCAGTGTGCCAAATCGCCTTGAAGAAGAGAGCCAAGACGACCTGCCAG
TGAAACTGAGTATTGCTGGCTTGAATGATTTTTCTCCTGACCGCATCGCCCAACAAGTGCCTGAATTACG
TAAGTTGCTTGATTTACGTGAAGCATTGGTCGCGCTGAAAGGCCCCCTCGGCAATATTCCCTCATTCCGT
AATCGTTTGCAGGATCTGTTGTCCAGCGAAGAAGCCAGAGAGCAGCTTTTGAAAGAGCTCGATCTGGTGA
AACCCGCCGAATAA