SecReT6
Protein ID: 470153451
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0963
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1065293..1066771 [+]
ProductType VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDK4FKB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-184, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|470153451|ref|YP_006281953.1| Type VI secretion protein, EvpB/VC_A0108 family [Pectobacterium sp. SCC3193]
MSIVEEQVQAGAASASGSLLDDIMAQARISPVDEGYSVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAKELQELESSWRSMKLLIDRTDFRENIKLLVLHATKEELLEDFEFAPEISQSGFY
KHVYSSGYGQFGGQPIGGVIGDYALTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDRFTDLPSIK
DLKSVFEGPAYTKWRSLRESEDGRYLGLTAPRFLARLPYDPVENPIKGFNYKEDISTDHEHYLWGNTAYL
MGTALTDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFPNTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWIKQYIADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMSVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1065293-1066771 Pectobacterium sp. SCC3193, complete genome
ATGTCAATAGTTGAAGAACAGGTTCAGGCAGGAGCCGCCAGTGCTTCTGGATCGTTGCTTGATGACATCA
TGGCTCAAGCGCGTATCAGCCCGGTTGATGAAGGCTACAGCGTGGCTAAACAGGGCATTGCCGCGCTGGT
CGCTAACATTCTTGATAGCGGTAATGCAGCAGAACCCGTGAATAAAGCGCTGGTCGATAGCATGATCGTC
GAACTGGACAAAAAACTTAGCAAGCAGATTGACGTGATTCTGCATGCAAAAGAATTACAGGAACTGGAAT
CTTCCTGGCGTTCGATGAAACTGCTTATCGATCGCACTGATTTCCGTGAAAACATCAAACTGTTGGTGTT
GCATGCGACGAAAGAAGAGCTGTTGGAAGATTTCGAATTCGCCCCTGAAATCTCACAGTCTGGCTTCTAT
AAGCACGTGTATTCCAGCGGTTACGGCCAGTTCGGCGGTCAGCCTATTGGTGGCGTGATCGGTGACTATG
CGCTGACGCAAAGCTCACCAGACATCAAACTGATGCAGTATGTCAGCGCCGTTGGCGCGATGGCGCATGC
ACCGTTCATCTCTTCCGTTGCACCAACCTTCTTTGGCGTGGATCGCTTCACCGATCTGCCTTCAATCAAA
GATCTGAAATCCGTTTTCGAAGGCCCTGCCTACACGAAATGGCGTTCGCTGCGTGAATCTGAAGACGGCC
GCTATCTGGGGCTGACGGCACCGCGCTTCCTGGCTCGCTTGCCTTATGATCCGGTAGAAAACCCGATTAA
GGGTTTCAACTACAAGGAAGATATCAGCACCGATCACGAACACTATCTGTGGGGCAATACCGCTTATCTG
ATGGGAACGGCATTGACGGACAGTTTCGCGAAATACCGCTGGTGTCCGAACATTATCGGTCCACAGAGCG
GTGGGGCGATTACCGACCTGCCGGTGCATGTTTATGAAGCGATGGGCCAACTTCAGGCCAAAATCCCGAC
TGAAGTGCTGATCACCGATCGTCGCGAATATGAAATGGCCGAAGAAGGCTTTATCACGCTGACGATGCGT
AAAGACAGTGACAATGCCGCCTTCTTCTCCGCTAACTCAGTGCAGAAGCCGAAGGTGTTCCCAAACACCA
AGGAAGGCAAAGAAGCGGAAACCAACTACAAGCTGGGTACGCAACTGCCGTACATGTTCATCATCAACCG
TCTGGCGCACTACATCAAAGTGCTTCAGCGTGAACAGATTGGCTCATGGAAAGAGCGTCAGGATCTTGAA
CGTGAGTTGAATACCTGGATTAAACAGTACATCGCCGATCAGGAAAACCCGCCGGCAGATGTCCGTAGCC
GTCGTCCTCTGCGTGCTGCACAAATCAAAGTGCTGGATGTGGAAGGAGAACCAGGTTGGTATCAGGTCAC
TATGTCTGTGCGCCCGCACTTCAAGTACATGGGGGCAAACTTTGAGCTGTCGCTGGTAGGGCGTCTGGAT
AAGGAATAA