SecReT6
Protein ID: 470153452
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0964
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1066777..1067208 [+]
ProductType VI secretion system lysozyme like protein
NoteTssE
UniProt IDK4FF68
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-20, Aligned region: 33..123
Protein Sequence: 143 a.a.     [Download]
>gi|470153452|ref|YP_006281954.1| Type VI secretion system lysozyme like protein [Pectobacterium sp. SCC3193]
MPSLSAWERGNAASLFDRIRGEGRRSSPETDVEALIESVKRQLDNVLNTRPGNCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVDTSDYLSNPMEMSFQVTARVRLEDLEQVASFNIHMDSHRHY
RMI
 
Nucleotide Sequence: 432 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1066777-1067208 Pectobacterium sp. SCC3193, complete genome
ATGCCGTCTCTTTCTGCCTGGGAAAGGGGAAACGCGGCAAGTCTGTTTGATCGTATCCGTGGGGAGGGGC
GTCGTTCCTCCCCTGAAACGGACGTTGAAGCACTGATCGAGTCCGTTAAGCGTCAACTGGACAATGTGCT
CAACACCCGGCCCGGAAATTGTCGCAGCGCACCTGAGCTTGGCGTGATTGATTTTAATGACGCGACGCAG
GGTGGTGCGGATATTCGGGGGAAAATCCGGGAGGCGATCCGGCAGTGTATCTGTCGCTTTGAACCTCGAA
TTGTTCATGTGGATGTCGACACATCGGACTATTTATCGAATCCGATGGAGATGTCGTTTCAGGTTACCGC
TCGGGTCAGGTTGGAAGACCTGGAGCAGGTTGCCTCTTTCAATATCCATATGGATAGCCACCGCCATTAC
AGAATGATCTGA