SecReT6
Protein ID: 470153453
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0965
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1067211..1068977 [+]
ProductType VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDK4FG92
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-200, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|470153453|ref|YP_006281955.1| Type VI secretion protein, VC_A0110 family [Pectobacterium sp. SCC3193]
MSLEHFFRDELTYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTMMQFSVHPGAIAQPAFVERGCELDSLPIDDVVCHFQTCHDIWIYPADIREIKVQ
SGNDLSTITLDIGLHGPLSLSDLQLDKLRFYLGGDTYTAYELYFWIASQLSHIELEVDGQRFRQEASVLK
TVGFEREDALLPYPGNVYSGYRILQEYFCFPESFLFFQLAGAVWPDLPLTVTEFRLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFRHDSEPINLSGRQTDYPLKASYRNADSFEIFSVDKVEGWVEGNSGRARGIPRTY
QPFESFQHQIERAKGRLALYYRIRIREAVNGNGFEHMLSFVRGDEREVIDLDESISVTLTCTNRSRAAQL
PVGAICVPAGNSPSFATFRNLLRPTRPLRPAMDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIESIETTPIDRLVQGMPVRGLKSILSVRQSAFSSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1067211-1068977 Pectobacterium sp. SCC3193, complete genome
ATGTCACTGGAACATTTTTTCAGGGATGAGCTGACTTACTTGCGCCTGCAAGGGCGCGAATTCGCCAAGG
CGCACCCTGAGCTTACCCGATTTTTGTCAGAACAAACCACGGATCCAGACGTTGAGCGACTGCTGGAAGG
GTTCGCCTTTTTGACAGGGAGCCTGCGGGCGAAGATCGAGGATGAATTTCCGGAACTGACACACGGTCTG
CTGGGCATGCTCTGGCCTAATTACCTGCGTCCAGTACCGAGCATGACGATGATGCAATTTTCGGTGCATC
CCGGCGCGATTGCACAGCCCGCATTTGTTGAGCGCGGTTGTGAACTCGATAGCCTGCCGATTGATGATGT
GGTCTGCCATTTTCAGACCTGTCACGATATCTGGATTTATCCGGCGGATATCCGCGAGATTAAGGTACAA
AGCGGTAACGATCTTTCCACCATTACGCTGGATATAGGGTTGCATGGCCCGTTATCGCTAAGCGATCTGC
AACTCGACAAGCTGCGCTTTTATCTGGGCGGCGATACCTATACGGCCTACGAACTCTATTTCTGGATCGC
CAGCCAACTGTCGCATATTGAGCTGGAAGTCGATGGCCAACGCTTCCGTCAAGAGGCCAGCGTGCTGAAG
ACGGTCGGCTTCGAGCGAGAAGATGCGCTATTACCGTATCCCGGCAATGTCTATTCGGGCTACCGCATCC
TGCAGGAATACTTTTGCTTTCCTGAAAGTTTTCTCTTTTTCCAACTTGCTGGCGCGGTATGGCCGGATCT
TCCGCTGACGGTAACGGAGTTCCGTCTGCATTTTTGTTTTGATCGTCCGTTGCCAGCGGAGCTGAAGATC
CGTCCTGATTCATTCATGCTCAACTGCGTGCCTGCAATCAATCTCTTCCGACACGATAGCGAGCCGATCA
ACCTTAGCGGACGTCAGACGGATTACCCGCTGAAGGCCAGTTACCGTAACGCCGATAGCTTTGAAATCTT
CTCTGTGGATAAGGTTGAGGGGTGGGTTGAAGGCAATTCAGGTCGTGCTCGGGGTATCCCACGCACGTAT
CAGCCCTTTGAGAGCTTTCAGCACCAAATCGAGCGAGCTAAAGGGCGATTGGCGCTCTATTACCGTATTC
GGATAAGAGAAGCGGTGAACGGCAATGGTTTTGAACACATGCTCTCTTTTGTGCGGGGCGATGAGCGGGA
AGTCATTGATTTGGATGAATCCATCTCGGTGACTCTGACCTGTACCAATCGGTCGCGTGCGGCACAACTG
CCCGTTGGGGCGATTTGTGTACCAGCCGGTAACTCACCGTCTTTCGCGACGTTTCGTAATTTGTTACGGC
CAACGCGGCCACTGCGGCCTGCGATGGATGGCAGCCTGCATTGGACGCTGATCTCCAACCTGTCGCTGAA
CTATGTGTCGCTGCTGCGGCGTGATGCGTTGGTACAGATCCTACGTACCTACGATTTCCCAGCGCTGCAC
GACAAGCAGGCGGAACAAGCCTCGCGTAAGCGTCTGGCGGGTATCGAGTCTATCGAAACCACGCCTATCG
ATCGCCTGGTTCAGGGGATGCCGGTTCGTGGCTTGAAATCAATCCTGTCTGTACGGCAATCCGCGTTTTC
CAGTGAAGGAGAACTGTACCTGTTTAGCACGGTGCTGGCGCACTTTTTCTCGCTATACGCCAGCGTCAAC
GCTTTCCACCTGTTGGAAGTGGTCAACATCGATAACAAGGAGCGCTACCGATGGCCGGTACAGATAGGTC
AACACTCAATGATGTAA