SecReT6
Protein ID: 470153454
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0966
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1068941..1069939 [+]
ProductType VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDK4FFR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.60E-96, Aligned region: 16..319
Protein Sequence: 332 a.a.     [Download]
>gi|470153454|ref|YP_006281956.1| Type VI secretion protein, VC_A0111 family [Pectobacterium sp. SCC3193]
MAGTDRSTLNDVTFRQDVSRFNFFQLVELLNQLEGVDLEQELDFRPEQERLRFRSTASIGFHPSDILRVG
CDEEGRQELEVAFLGLHGSQSPMPGYYLEELAWEYAQGEQKLGVFLDFFHHRLLTLLHRAWRKYRYHVRF
QNEGEDGFSRLMFALVGLGNDAVRDSLPVNRAKMLSYAGVLASPSRSPEVVAGLVIHCFDLDDVAVLAWQ
HRRVPIHEGQQNRLGKGNMMLGGDFVIGDKVNDCAGKFLLKIGNLSFSRFLSFLPNGEHFQPLVRFVSFI
LRDQLAWDLRLGFAEDEAKGLSLGSEQSSRLGWSSFLGQPPADPYVTICVQE
 
Nucleotide Sequence: 999 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1068941-1069939 Pectobacterium sp. SCC3193, complete genome
ATGGCCGGTACAGATAGGTCAACACTCAATGATGTAACGTTCCGTCAGGATGTCTCACGCTTCAATTTTT
TCCAACTGGTGGAATTACTCAACCAGTTGGAAGGCGTGGATCTGGAACAAGAGCTGGATTTTCGCCCTGA
ACAGGAACGTCTGCGTTTTCGCTCCACGGCCTCCATCGGTTTTCACCCCAGCGATATCTTGCGGGTGGGG
TGTGATGAAGAGGGCCGTCAGGAATTGGAAGTCGCGTTCCTGGGCCTGCACGGTAGTCAGTCGCCGATGC
CCGGCTATTACCTCGAAGAACTGGCTTGGGAATACGCGCAGGGCGAACAGAAGCTGGGCGTGTTTCTCGA
TTTCTTTCATCACCGCTTACTCACGCTGTTGCACCGCGCATGGCGGAAATATCGCTATCACGTCCGCTTT
CAGAATGAGGGGGAGGATGGATTCTCCCGTCTGATGTTTGCGCTCGTGGGCTTGGGCAATGATGCCGTGC
GCGACAGTCTGCCGGTTAACCGCGCCAAGATGCTTTCCTACGCTGGGGTGTTGGCAAGCCCCAGCCGTTC
CCCTGAAGTGGTCGCCGGGTTAGTTATTCACTGTTTTGACCTGGATGATGTTGCCGTCTTGGCCTGGCAG
CACCGCCGCGTTCCCATTCATGAAGGGCAGCAGAACCGGCTGGGAAAAGGAAACATGATGCTGGGCGGTG
ATTTTGTCATCGGTGACAAAGTGAATGATTGTGCCGGCAAGTTCTTGCTCAAGATCGGCAATCTCAGTTT
TAGCCGCTTTCTCAGCTTTCTGCCCAACGGTGAACATTTTCAGCCGCTGGTGCGTTTTGTCTCTTTCATT
CTTCGCGATCAGTTGGCTTGGGATCTCCGTCTTGGTTTCGCAGAAGATGAAGCTAAGGGCTTAAGTCTGG
GCAGCGAGCAAAGCAGCCGTTTGGGGTGGAGCAGCTTTCTCGGGCAGCCGCCAGCGGATCCCTATGTGAC
GATTTGTGTGCAGGAGTAA