SecReT6
Protein ID: 470153455
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0967
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1069942..1071162 [+]
ProductType VI secretion system FHA domain protein
NoteFha
UniProt IDK4FQL4
KEGG IDpec:W5S_0967
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.80E-05, Aligned region: 33..100
Protein Sequence: 406 a.a.     [Download]
>gi|470153455|ref|YP_006281957.1| Type VI secretion system FHA domain protein [Pectobacterium sp. SCC3193]
MNVTHPLTLVVLNSEQLDINSQVQHQFDHLGGTLGASEKDQWQLRDRLGSVLPAHARIEMTDGYFSLCDL
SGQSFINGSLSPIGRDRNVILSHGDELVIGPFRLGVYIGDPTTEQDIDQVLGLRTDDVLGGWLSEKKKGR
TAESADTAAVMNDPLWALQKEQSQPLLPSDSERGGESLTTSLSSFSAVEDTMDQKFVELPSINTPYAGEG
LEGYSDGTSLAPLMRGLGLSLQPGDDARLREMLEEMGKSLRAMVEGLLTLQTEQAALADTHLRPIEDNPL
RLGLGYADTLSVLFAEGKSPVHLSAPAAVEEVLNNVRVHHIANQQAIAAALENILQAFSPDALLSRFEHY
RRSGEPLAADDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1069942-1071162 Pectobacterium sp. SCC3193, complete genome
GTGAACGTAACCCATCCACTCACGTTGGTTGTGCTCAACAGTGAGCAGCTCGATATCAATTCTCAGGTGC
AGCATCAGTTTGATCACCTCGGTGGCACGCTGGGTGCATCGGAAAAAGATCAGTGGCAGCTACGCGATCG
ATTGGGATCGGTGTTACCCGCGCATGCACGTATCGAAATGACCGATGGTTATTTCAGTCTATGCGATCTG
AGCGGGCAGTCTTTTATTAACGGTTCGCTGTCGCCGATTGGGCGGGATCGCAACGTCATTTTGTCGCACG
GCGATGAATTGGTGATTGGGCCTTTTCGGCTGGGCGTTTACATCGGCGATCCCACGACGGAACAGGATAT
CGATCAGGTGTTAGGGCTGCGCACGGACGATGTGTTAGGCGGCTGGTTAAGTGAAAAGAAAAAAGGGCGA
ACGGCAGAGAGTGCAGATACTGCGGCCGTGATGAATGACCCGCTGTGGGCGCTACAGAAAGAACAGAGCC
AGCCACTATTGCCATCAGACAGTGAGAGAGGCGGAGAATCGCTCACGACCTCTCTTTCTTCTTTTTCTGC
TGTTGAGGACACCATGGATCAGAAATTTGTCGAATTACCGAGCATCAATACCCCCTACGCGGGAGAAGGG
CTGGAAGGGTACAGCGACGGCACTTCGCTGGCTCCGTTGATGCGTGGCCTGGGGCTGTCGCTTCAGCCGG
GTGATGATGCTCGCCTGCGTGAAATGCTGGAAGAAATGGGGAAAAGCCTGCGTGCGATGGTTGAAGGGCT
GCTGACATTGCAGACGGAACAGGCCGCACTGGCGGACACGCATTTACGCCCGATTGAAGATAACCCGCTG
CGTCTGGGGCTGGGCTATGCGGATACGCTGTCGGTGCTGTTTGCCGAAGGGAAAAGCCCGGTTCACCTGT
CTGCACCTGCTGCGGTGGAAGAAGTGTTGAACAATGTGCGGGTGCATCACATCGCGAATCAGCAAGCGAT
TGCTGCGGCGTTGGAAAATATTCTTCAGGCCTTTTCGCCAGACGCGCTGCTCAGCCGCTTTGAGCATTAT
CGCCGTAGTGGTGAACCACTGGCGGCGGATGACGGCTGGGCATGGCAAATGTATCAGCACTACTACCGAG
AATTGACGTCGCCACGTCAGCAAGGTTTCCAGAAACTGTTCCATCAGGTGTATGCGCAGGCGTATGACCG
TGCCGTGCGCCAACAGCAGGAGCAAAAATGA