SecReT6
Protein ID: 470153456
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0968
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1071159..1071683 [+]
ProductType VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDK4FKB5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-37, Aligned region: 12..165
Protein Sequence: 174 a.a.     [Download]
>gi|470153456|ref|YP_006281958.1| Type VI secretion lipoprotein, VC_A0113 family [Pectobacterium sp. SCC3193]
MMLRAFCLCSLMVVLSGCSTLSKMAQVAANPDIQVGSNNHQPSTVGFSLLAEPDVNPNESGEAAPIEFQL
VLLAEDSRLLATDYDQITTDIEKALAKNYLSHQDYTLLPGQFKYLPPEALDEKVHYLGVVARYADSESAE
WRKVIKLKNVGQTYQILVHLRRDEVEIKKDQEEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1071159-1071683 Pectobacterium sp. SCC3193, complete genome
ATGATGCTGCGGGCATTTTGCTTATGTTCGCTGATGGTCGTGCTGTCGGGGTGTTCCACGCTGAGCAAGA
TGGCGCAGGTCGCGGCGAATCCTGATATCCAGGTGGGCAGCAACAATCATCAGCCTTCTACCGTGGGTTT
TAGCCTGCTGGCGGAACCGGACGTTAACCCGAATGAAAGTGGTGAAGCTGCACCTATCGAATTCCAACTG
GTCCTGCTGGCGGAAGATTCTCGCCTGTTAGCCACGGATTATGATCAGATCACGACGGATATCGAAAAGG
CGCTGGCCAAGAATTACCTCAGTCATCAGGACTACACGCTGTTGCCGGGGCAGTTCAAATACCTGCCGCC
AGAAGCGTTGGATGAAAAGGTGCACTACCTCGGCGTGGTCGCTCGCTATGCGGATTCGGAAAGTGCGGAA
TGGCGCAAGGTGATCAAGCTAAAAAATGTCGGGCAAACGTATCAGATCCTCGTGCACCTGCGCCGGGATG
AAGTCGAAATCAAAAAAGACCAAGAAGAAGAATAA