SecReT6
Protein ID: 470153457
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0969
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1071686..1073023 [+]
ProductType VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDK4FF71
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.90E-160, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|470153457|ref|YP_006281959.1| Type VI secretion protein, VC_A0114 family [Pectobacterium sp. SCC3193]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLEINEEYLNFGRIALVNASGVMP
DGTVFNIPGDDALPLPLEITDVALANQKVYLALPLAVNGVSEVGQPGQGIASRLQSHRHDVRDLHSDGGD
IVSLEVGKVSLRLMLDRDDRSAYASLAIANILDKRPDGGLILDPNFMPCSISVTAIPALKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPRLSHLARLGTLHPERLHEALVELCGELMTFTDES
RLPPEFPAYRHEHQQASFEPLMMALRQALSTVLSPRAVSIQLKKQPYGVMVAMVGDAELMASAEFVLAVR
ARMPQEHLRKQLLQQTKIASSEKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQVLVS
GNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1071686-1073023 Pectobacterium sp. SCC3193, complete genome
ATGTCGAGTCGCAATCGCATTATCTGGCGGGAAGGTTTGTTCATTAAACCGCAACATTTTCAACAGCAGC
AAAGACATACCGATTACGCATTGCATGCGCGTCTCAGCGCACTGAGTGATTATTTTTATGGCTTGCAATC
GCTGGAGATTAATGAGGAATACCTCAATTTTGGCCGCATCGCACTGGTTAATGCCAGCGGGGTGATGCCT
GATGGCACCGTGTTCAATATTCCGGGCGATGACGCCTTGCCGCTGCCGTTGGAGATCACCGACGTCGCGC
TGGCAAACCAGAAAGTGTATCTGGCACTACCGCTGGCGGTAAATGGCGTCAGCGAAGTGGGCCAACCGGG
ACAGGGGATCGCCAGCCGTTTGCAATCACACCGGCATGACGTGCGCGATCTGCATAGCGACGGCGGCGAT
ATCGTTTCTCTGGAGGTCGGCAAGGTTAGTCTGCGGTTGATGCTCGATCGTGACGATCGCAGCGCCTATG
CCTCGCTGGCGATTGCCAACATTCTGGATAAACGCCCTGACGGCGGCTTGATCCTGGATCCTAATTTTAT
GCCATGCAGCATCAGCGTTACGGCGATCCCTGCCTTAAAACGCTTCCTGGGGGAATCTGCCGGTCTGGTT
GCCGAACGTGCGCGCAGTCTGGCGCAGCGTATTGCCGCGCCGGGGCAACAGGGCGTGGCGGACGTAGCGG
AATTCATGATGCTGCAATTGCTTAACCGCGCCCAGCCCAGATTGTCGCATCTGGCCCGCCTTGGCACGCT
ACACCCCGAGCGCCTGCACGAGGCGTTAGTCGAGCTGTGTGGTGAACTGATGACGTTTACCGATGAGTCG
CGCCTGCCGCCTGAATTCCCGGCCTATCGTCATGAACATCAGCAAGCCAGCTTTGAGCCGCTGATGATGG
CGCTGCGTCAAGCCCTGAGCACCGTACTGTCACCGCGTGCCGTTTCCATCCAACTGAAGAAACAGCCGTA
TGGCGTGATGGTGGCGATGGTTGGCGATGCGGAATTGATGGCCAGCGCCGAGTTTGTACTGGCGGTGCGT
GCGCGTATGCCGCAGGAGCATCTGCGTAAACAACTGCTGCAACAAACGAAAATTGCCTCCAGCGAGAAGA
TCCGCGAACTGATCAGCCTACAACTGCCTGGCATTCCACTGCTGCCGCTGCCGGTTGCACCGCGTCAACT
GCCTTATCACGCGGGTTACAGCTATTTCCAACTGGATAGGCAAAGCCCCGCCTGGCAAGTGCTGGTATCT
GGCAATACGTTGGCGTTCCACATTGCTGGCGAGTTCCCGGAACTGGATATGCAGCTTTGGGCCATCCGCG
GTCAGTAG