SecReT6
Protein ID: 470153458
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0970
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1073039..1073815 [+]
ProductImpK/VasF outer membrane protein
NoteTssL
UniProt IDK4FG94
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.80E-70, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|470153458|ref|YP_006281960.1| ImpK/VasF outer membrane protein [Pectobacterium sp. SCC3193]
MSIEVIKNDQLGDLLFDHARQLDMDSDYWFRLRGQSINPMIDAVTPLLGMVERVRQLSAYEGVEDLYQRV
VSEVQAIEQELHSHSYENGVILSFRYILCTFIDEAVMGREWGGQSMWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPTRYRDILEFIYLCLCLGFEGRYRVMTQGREELDRVVSKLHDTLRPEPTNAPTVFHLNLGQQAS
RYQLRRQVSLRTLFIGVCVALVAAFGLYRYQLTHQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1073039-1073815 Pectobacterium sp. SCC3193, complete genome
ATGAGCATCGAGGTTATTAAGAACGATCAACTGGGCGATCTGCTTTTTGACCACGCCCGACAGTTGGATA
TGGATTCCGACTACTGGTTCCGCCTGCGTGGACAAAGCATTAATCCGATGATTGATGCCGTTACGCCGTT
ATTGGGCATGGTGGAGCGGGTACGCCAGCTCTCTGCCTATGAGGGCGTGGAGGATCTCTATCAGCGCGTG
GTATCTGAAGTTCAGGCTATCGAACAGGAATTGCACTCTCATAGCTATGAGAACGGTGTGATCCTGTCTT
TCCGCTACATCCTCTGCACGTTTATTGATGAAGCCGTGATGGGGCGGGAGTGGGGTGGACAAAGCATGTG
GTCGGCACACTCTCTGCTGACTCGTTTTCATAATGAGACCTGGGGGGGCGAAAAGGTTTTCGTCCTGCTA
GAGAAGCTGTTGGACGATCCTACCCGCTATCGCGACATTCTGGAGTTTATCTACCTCTGCCTTTGTCTGG
GCTTTGAAGGGCGCTATCGGGTGATGACTCAAGGGCGTGAAGAGCTGGATCGCGTCGTGAGTAAGCTACA
TGACACCCTGCGCCCTGAGCCTACGAATGCGCCAACGGTATTCCACCTGAATCTGGGGCAGCAGGCCTCG
CGCTACCAACTGCGTAGGCAGGTGTCATTGCGCACGTTGTTTATCGGCGTGTGTGTAGCTTTGGTGGCCG
CATTCGGCCTGTACCGTTACCAGCTTACTCATCAGACCCAGGACGTACTGCGTCAACTGGGAGAATTATT
ACAATAA