SecReT6
Protein ID: 470153459
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0971
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1073829..1076426 [+]
ProductType VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDK4FFR3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.20E-38, Aligned region: 275..325
AAA_2 [PF07724], Evalue: 5.20E-38, Aligned region: 602..763
AAA [PF00004], Evalue: 9.40E-18, Aligned region: 219..331
AAA [PF00004], Evalue: 9.40E-18, Aligned region: 537..563
AAA [PF00004], Evalue: 9.40E-18, Aligned region: 608..726
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 219..239
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 607..725
ClpB_D2-small [PF10431], Evalue: 1.60E-10, Aligned region: 427..443
ClpB_D2-small [PF10431], Evalue: 1.60E-10, Aligned region: 769..842
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 135..173
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 196..236
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 257..297
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 465..524
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 581..646
AAA_16 [PF13191], Evalue: 3.70E-10, Aligned region: 673..701
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 218..309
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 606..625
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 669..701
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 219..246
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 415..449
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 608..631
NACHT [PF05729], Evalue: 8.60E-05, Aligned region: 813..837
DUF258 [PF03193], Evalue: 0.0001, Aligned region: 184..236
DUF258 [PF03193], Evalue: 0.0001, Aligned region: 608..623
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 605..629
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 216..241
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 357..396
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 522..549
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 601..625
AAA_19 [PF13245], Evalue: 0.00037, Aligned region: 802..824
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 199..233
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 272..306
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 608..628
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 678..693
Arch_ATPase [PF01637], Evalue: 0.00064, Aligned region: 778..807
AAA_25 [PF13481], Evalue: 0.00084, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 0.00084, Aligned region: 430..480
AAA_25 [PF13481], Evalue: 0.00084, Aligned region: 602..636
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 219..285
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 460..511
AAA_17 [PF13207], Evalue: 0.0011, Aligned region: 608..642
Zeta_toxin [PF06414], Evalue: 0.0016, Aligned region: 216..236
Zeta_toxin [PF06414], Evalue: 0.0016, Aligned region: 405..443
Zeta_toxin [PF06414], Evalue: 0.0016, Aligned region: 606..647
IstB_IS21 [PF01695], Evalue: 0.0023, Aligned region: 213..243
IstB_IS21 [PF01695], Evalue: 0.0023, Aligned region: 607..618
Sigma54_activat [PF00158], Evalue: 0.0027, Aligned region: 219..233
Sigma54_activat [PF00158], Evalue: 0.0027, Aligned region: 607..705
AAA_10 [PF12846], Evalue: 0.0064, Aligned region: 217..238
AAA_10 [PF12846], Evalue: 0.0064, Aligned region: 281..305
AAA_10 [PF12846], Evalue: 0.0064, Aligned region: 389..440
AAA_10 [PF12846], Evalue: 0.0064, Aligned region: 607..638
Ras [PF00071], Evalue: 0.0075, Aligned region: 219..232
Ras [PF00071], Evalue: 0.0075, Aligned region: 608..649
MobB [PF03205], Evalue: 0.0082, Aligned region: 219..240
MobB [PF03205], Evalue: 0.0082, Aligned region: 607..626
Protein Sequence: 865 a.a.     [Download]
>gi|470153459|ref|YP_006281961.1| Type VI secretion ATPase, ClpV1 family [Pectobacterium sp. SCC3193]
MIRIELPTLVERLNPVCRHMLEEAAALCIQHQGAEIRIEHLLMKMLETPLCDVRQILKRAGVDADELSSL
LLPSSVDKEFDAGYPSFSPLLVEWLQDSWLLASAEFQHVRLRSGILLLVLLLTPNRYVAGAVSRPLAQIN
RELLRQQFDEWVKDSVETDVAVQSATAEQAAAANTQLSRYTQNVTESARQGQLDPVLCRDHEIDLMIDIL
SRRRKNNPIVVGEAGVGKSALIEGLALRIVAGAVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVMQ
EVKDAPRPIILFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRFQ
LVKVGEPNAEEATVILRGLRGIYEKAHGVLIDEDALQAAAQLSARYISGRQLPDKAIDVLDTASARVAIN
LTTPPRAVSQLQTRLRQQEMEITQLERQARIGLGNTEDRLVELRNAREAGAAQLVQLEADWQQQKTQVQR
VIELRTALLDEDQAVDFDAVSAAAELADCEQALEALQQSSVLVSPHVDKTQIAAVIAEWTGVPLNRISQG
EMDIVTRLPEFLGETIKGQQLAIAQLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVVQIADLMFG
GRNYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAF
DKGELADGEGRVIDCRNVVFFLTSNLGFQTIVNYAEQSDVLLDALYPELAAFFKPALLARMEVIPYLPLA
HATMVEIVQGKLSRLVSLLQQRFSAEVIIEDEVPEEILRLANRSENGARMLESVIDGALLPPVSLQLLQR
LSAGEPVSRIHFRVEAGQFQTEVEG
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1073829-1076426 Pectobacterium sp. SCC3193, complete genome
GTGATTCGAATTGAACTGCCGACACTGGTTGAACGACTCAACCCCGTGTGCCGTCATATGCTGGAAGAAG
CGGCGGCACTCTGTATTCAGCATCAGGGTGCGGAAATCCGTATTGAGCACTTGTTGATGAAAATGCTGGA
AACGCCGCTGTGTGATGTGCGGCAGATCCTCAAGCGTGCGGGCGTTGATGCGGATGAGTTGTCTTCGCTG
CTGTTGCCTTCCTCCGTGGATAAAGAATTTGACGCGGGCTATCCCTCATTCTCCCCTCTGCTGGTGGAGT
GGTTACAGGATAGCTGGCTGCTGGCCTCGGCTGAGTTTCAGCACGTGCGTCTGCGCAGCGGCATATTGTT
GCTGGTCTTGCTGCTGACGCCCAATCGCTATGTGGCAGGCGCGGTGTCCCGCCCGCTGGCGCAGATTAAC
CGTGAACTTTTACGCCAGCAGTTTGATGAGTGGGTGAAAGATTCGGTGGAAACGGACGTCGCGGTGCAGT
CCGCCACGGCCGAACAGGCAGCCGCGGCGAACACGCAGCTCTCGCGCTATACGCAAAATGTGACGGAATC
CGCTCGACAAGGGCAGTTGGACCCGGTGTTGTGCCGCGACCATGAAATCGATCTGATGATCGATATTCTC
TCCCGTCGTCGTAAAAACAACCCGATTGTCGTGGGGGAAGCGGGTGTTGGTAAAAGTGCGCTGATCGAAG
GGCTGGCGCTGCGTATTGTGGCGGGTGCCGTGCCGGAAAGACTACGAGATGTAGAACTGCTTACGCTCGA
TTTGGGGGCGATGCAGGCGGGTGCGTCAGTTAAAGGCGAATTTGAGAAACGCTTCAAAGGTGTGATGCAG
GAAGTGAAGGATGCGCCACGCCCGATCATTCTATTTATTGATGAAGCGCATACGCTAATCGGGGCAGGCA
ATCAGGCCGGTGGGCTGGATGTGTCCAATCTGCTTAAGCCTGCGCTGGCGCGTGGTGAGCTGCGTACCAT
CGCGGCAACCACCTGGAGCGAATACAAAAAATATGTCGAGAAGGACGCTGCGCTTTCCCGTCGCTTCCAG
CTCGTCAAAGTCGGTGAACCGAACGCGGAAGAAGCCACGGTGATCCTGCGTGGGCTGCGCGGTATCTATG
AAAAAGCACATGGCGTCCTGATTGATGAAGATGCGCTTCAGGCGGCGGCGCAACTGTCGGCGCGCTATAT
CTCTGGTCGCCAACTCCCCGATAAAGCGATTGACGTGCTGGATACCGCGAGTGCGCGCGTAGCCATTAAC
CTGACGACACCACCGCGTGCCGTCAGCCAGCTACAGACCCGTCTACGCCAGCAGGAAATGGAAATCACCC
AGCTTGAGCGGCAGGCGCGCATCGGTCTGGGCAATACCGAAGACCGCTTAGTGGAACTGCGTAATGCTCG
CGAAGCCGGCGCGGCACAGTTGGTACAGTTAGAAGCCGATTGGCAGCAGCAGAAAACGCAGGTTCAGCGC
GTGATTGAACTGCGCACGGCGTTGCTGGATGAAGATCAAGCCGTCGATTTCGATGCTGTGTCGGCTGCGG
CGGAACTGGCGGACTGCGAACAGGCGCTGGAAGCGTTGCAACAATCCTCCGTGCTGGTCTCTCCTCACGT
TGATAAAACACAGATTGCTGCCGTGATAGCTGAGTGGACGGGCGTGCCGCTTAACCGAATCTCGCAGGGT
GAAATGGATATCGTCACGCGCCTGCCTGAATTCCTGGGTGAAACGATTAAAGGACAGCAGTTGGCGATTG
CTCAATTGCATAAACATTTGCTGACCGCGCGTGCGGATCTTCGTCGTCCTGGGCGTCCGTTGGGGGCTTT
CCTGCTGGTGGGGCCGAGCGGCGTGGGTAAAACGGAAACCGTGGTCCAGATTGCCGACCTGATGTTTGGC
GGACGTAACTATCTGACCACCATCAATATGTCGGAATATCAGGAGAAACATACCGTTTCACGCCTGATCG
GTTCGCCGCCGGGCTACGTCGGGTTTGGTGAGGGGGGCGTATTGACCGAAGCGATCCGCCAGAAACCGTA
TTCCGTGGTACTGCTGGATGAAGTGGAAAAAGCACACCCGGATGTCCTGAATCTGTTCTATCAGGCCTTT
GATAAAGGTGAACTGGCCGACGGTGAAGGCCGGGTCATCGACTGCCGCAATGTGGTGTTTTTCCTGACGT
CCAATCTCGGGTTCCAGACGATCGTGAACTACGCCGAGCAGTCGGATGTGTTGCTGGATGCGCTCTATCC
TGAGCTGGCGGCTTTCTTTAAACCTGCACTATTGGCGCGTATGGAAGTCATCCCTTATCTGCCGCTGGCG
CATGCCACCATGGTCGAGATCGTACAGGGTAAATTGTCGCGTCTGGTTTCTCTGCTGCAACAGCGCTTTA
GTGCTGAGGTCATCATTGAGGATGAGGTGCCGGAAGAAATTCTCCGGTTGGCAAACCGCAGCGAAAACGG
GGCGCGTATGCTGGAGTCAGTGATTGATGGGGCATTGCTGCCACCGGTATCACTACAACTGCTGCAACGA
CTGTCTGCGGGGGAACCCGTCAGCCGTATTCATTTCCGCGTCGAAGCCGGCCAGTTCCAGACCGAGGTGG
AGGGCTGA