SecReT6
Protein ID: 470153462
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0974
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1078539..1079966 [+]
ProductHypothetical protein ImpA
NoteTssA
UniProt IDK4FF74
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.70E-16, Aligned region: 49..109
Protein Sequence: 475 a.a.     [Download]
>gi|470153462|ref|YP_006281964.1| Hypothetical protein ImpA [Pectobacterium sp. SCC3193]
MHAHPWCKRLQTSLPDEKLRAAVLADDPLWEKVETELVKLGSLAHNQVDLNAVAGYCLTLLESKTKDMRV
LVQLLRCLQHPAKATPFSTALMLLDSWLESYWVTAWPASPVQKQKLMIQIVRRFEGALPRIAESASSAEL
EQLQQLTEQVATRWGELVSDKASLVDELVQGFKRARQRQQAQEKANQTANLTPAASSSGATGEGETRAST
ASTPPVGSVEINSSDERGWRQTQLNVATLLVERHPDSPIGYRLRRHAIWSGIATPPMSAKGNKTQLAPVS
ADRVDEYQSALAQADLALWERIEQSLVLAPYWFDGHMLSASVASRLGHAPVATAIAEELSAFIQRLPELR
ELAFSDGAPFLTGKCSQWLQSSQPVRGGGGARQDDLATEAAACRDENGIGAAMLLLDERMRRLKEPRDRF
YAELVLADLLAEEGMKSLAAQHYQHMWQESQQLGLMQWEPGMVSRVERLAASRKK
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1078539-1079966 Pectobacterium sp. SCC3193, complete genome
ATGCATGCACATCCCTGGTGTAAACGCCTGCAAACTTCGTTGCCGGATGAGAAGTTGCGCGCTGCGGTGT
TGGCCGACGATCCGCTTTGGGAAAAGGTAGAAACAGAGCTGGTCAAACTGGGATCGCTGGCGCACAACCA
GGTCGATCTTAATGCGGTGGCGGGTTATTGCCTGACGTTGCTGGAAAGCAAGACCAAAGACATGCGGGTA
TTGGTGCAGCTATTGCGCTGCTTACAGCACCCGGCTAAAGCGACGCCGTTTTCTACCGCGCTGATGTTGC
TGGACAGTTGGCTGGAGAGTTACTGGGTTACCGCCTGGCCTGCCAGCCCGGTTCAAAAACAAAAGTTGAT
GATCCAGATTGTTCGGCGTTTTGAGGGCGCGCTCCCGCGCATTGCAGAGAGCGCATCCAGTGCAGAGTTA
GAGCAATTACAGCAGTTAACTGAGCAAGTGGCGACCCGCTGGGGCGAACTGGTTAGCGACAAAGCCTCGC
TGGTGGATGAGTTGGTGCAGGGCTTTAAACGTGCCAGACAGCGGCAACAGGCACAAGAGAAGGCGAACCA
AACGGCAAATCTGACCCCGGCAGCGAGCAGCAGCGGTGCCACTGGGGAGGGTGAAACTCGCGCCAGTACA
GCCTCTACGCCGCCTGTCGGTTCCGTGGAAATTAATTCATCCGACGAGCGCGGATGGCGGCAAACCCAGT
TGAATGTTGCGACGCTGCTGGTTGAGCGTCATCCCGACTCACCGATCGGCTACCGCCTGCGACGTCATGC
TATCTGGTCCGGCATTGCGACTCCGCCGATGTCGGCCAAGGGGAATAAAACCCAATTGGCACCCGTCTCG
GCAGATCGTGTGGATGAATACCAAAGTGCGCTGGCACAGGCTGATTTGGCACTGTGGGAACGTATAGAAC
AAAGTCTGGTGCTGGCTCCTTATTGGTTTGATGGCCATATGTTGTCGGCCTCGGTGGCATCGCGGTTGGG
GCATGCTCCTGTTGCGACAGCCATTGCTGAAGAGCTTTCTGCATTTATTCAGCGTTTGCCGGAGTTGCGT
GAACTGGCATTCAGCGATGGCGCACCATTTTTGACAGGGAAGTGTAGCCAGTGGTTGCAGTCCAGCCAGC
CGGTGCGCGGTGGTGGCGGCGCGCGGCAGGACGATCTGGCGACGGAGGCGGCTGCCTGTCGGGATGAGAA
CGGCATCGGGGCGGCGATGTTGTTATTGGATGAGCGCATGCGTCGCCTGAAAGAGCCTCGCGACCGTTTT
TATGCCGAGCTGGTACTGGCGGATTTACTCGCCGAAGAAGGAATGAAATCACTGGCAGCACAGCACTATC
AGCACATGTGGCAGGAAAGCCAGCAATTGGGCCTGATGCAATGGGAACCGGGAATGGTCAGCCGCGTGGA
GCGGTTGGCGGCATCCCGCAAAAAATAA