SecReT6
Protein ID: 470153464
SecReT6 ID649
T6SS typei1
Gene symbol-
Locus tagW5S_0976
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]1083662..1085098 [+]
ProductHypothetical protein ahaP
NoteTssA
UniProt IDK4FFR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.70E-39, Aligned region: 326..473
ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 39..98
Protein Sequence: 478 a.a.     [Download]
>gi|470153464|ref|YP_006281966.1| Hypothetical protein ahaP [Pectobacterium sp. SCC3193]
MQDAQQALKVGRDPRMLPEFDALRAEINKLSHASRPDVDWMLVHDMATTIFEKQGVDLQTAIYFTLARSR
LAGLTGFTESCEFLANLIVTQWDNFWPPVHQERARIEMLDWFIARISEVVRQYAISHEHKRLVYRCERAL
QLMSEKLHNTGLSRIPRVENLLHFVEGYTHLFDETEIVIVSDDQELKKQDMQIPPMVFFHSDMEPGATVQ
SGGASGSGQAALPAGSILIGREKGQMKPTVLKIEAHKKQKPAWFWFVSGLLTCALPVAAITGWQYWQEQK
ADALALLQQPAYALPTAPDHNDIRRVRIVLGEQKLQGMEGELINRYQAQLEQVKNASPFYLYQYGNGLKN
VMQQLYPDSLAVKEMERQWQIALERQQGDEPKTLGYEQARVRVNDTLQQLLELERQRRTVTISYLKSKLY
DMQKDLMSDVPFGIRLRELEARKIKSQSLTPAELRAMEDELRSFNIRLYRLQQGNSAS
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|470152509|ref|NC_017845.1|:1083662-1085098 Pectobacterium sp. SCC3193, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTTGGCCGAGATCCACGGATGCTGCCGGAGTTTGACGCACTTC
GGGCGGAAATTAACAAATTGAGTCATGCGTCTCGCCCTGATGTGGATTGGATGCTGGTGCATGATATGGC
CACCACCATCTTTGAAAAACAGGGCGTGGATCTTCAGACCGCGATCTACTTTACCCTGGCGCGTTCGCGT
CTGGCTGGCTTGACGGGCTTCACGGAAAGCTGTGAATTTTTGGCGAACCTGATCGTGACACAGTGGGATA
ACTTCTGGCCACCGGTGCATCAGGAACGGGCGCGTATCGAGATGCTGGACTGGTTTATTGCCCGTATCAG
CGAAGTCGTGCGGCAGTACGCCATCAGCCATGAGCATAAGCGACTGGTTTATCGTTGCGAACGTGCACTG
CAACTGATGAGTGAAAAGCTGCACAACACGGGGTTAAGCCGTATTCCTCGCGTCGAGAATCTGCTGCACT
TCGTCGAAGGTTATACGCATCTGTTTGATGAAACGGAAATTGTCATTGTGTCGGACGATCAGGAATTGAA
AAAGCAGGATATGCAGATTCCCCCTATGGTGTTCTTTCATTCAGATATGGAGCCTGGGGCGACGGTACAG
AGCGGGGGGGCATCGGGTTCAGGCCAGGCTGCATTGCCTGCGGGCAGCATTCTCATCGGACGGGAGAAAG
GGCAAATGAAGCCGACGGTATTGAAAATTGAGGCGCATAAAAAACAGAAGCCAGCCTGGTTCTGGTTTGT
TTCCGGGCTGCTGACCTGTGCCTTACCGGTTGCGGCCATTACGGGATGGCAGTATTGGCAAGAGCAAAAA
GCCGATGCGTTGGCGCTACTACAACAACCGGCGTATGCATTGCCCACAGCTCCTGACCATAATGACATTC
GCCGGGTGCGTATTGTTCTGGGTGAGCAGAAATTGCAGGGCATGGAAGGTGAGCTGATCAACCGCTATCA
GGCACAGTTGGAGCAGGTAAAAAATGCGTCACCGTTCTACCTCTATCAATACGGTAATGGATTGAAAAAT
GTGATGCAGCAACTCTACCCCGATTCGCTGGCGGTGAAGGAGATGGAGCGCCAATGGCAGATTGCGCTTG
AACGTCAGCAGGGTGATGAGCCGAAAACGCTGGGTTACGAACAGGCGCGTGTCAGAGTCAACGATACCTT
GCAGCAACTGCTGGAACTGGAGCGTCAGCGCCGGACGGTGACGATTTCCTACCTGAAATCAAAACTCTAT
GATATGCAAAAAGACCTGATGTCAGATGTTCCTTTCGGGATACGGCTGCGGGAACTTGAAGCGCGTAAAA
TCAAGAGCCAATCGCTAACGCCAGCGGAGTTGCGTGCGATGGAGGACGAACTGCGCTCCTTCAATATTCG
TTTGTACCGTTTGCAGCAGGGTAATTCTGCCAGCTAA