SecReT6
Protein ID: 470154867
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2409
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2593163..2595301 [-]
ProductType VI secretion system Vgr family protein
NoteTssI
UniProt IDK4FI03
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.70E-74, Aligned region: 22..327
Phage_GPD [PF05954], Evalue: 3.70E-74, Aligned region: 532..532
Phage_base_V [PF04717], Evalue: 1.30E-25, Aligned region: 365..458
Gp5_C [PF06715], Evalue: 7.00E-18, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 7.00E-18, Aligned region: 517..539
Gp5_C [PF06715], Evalue: 7.00E-18, Aligned region: 541..562
Gp5_C [PF06715], Evalue: 7.00E-18, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 7.00E-18, Aligned region: 565..587
Gp5_C [PF06715], Evalue: 7.00E-18, Aligned region: 581..602
Protein Sequence: 712 a.a.     [Download]
>gi|470154867|ref|YP_006283369.1| Type VI secretion system Vgr family protein [Pectobacterium sp. SCC3193]
MFSRITAQLPMNGLLFWKLSGTETLSHSFVLTADLLATGARIDRHALLGQPVTFTLPTQSLLSSRYLNGK
ITRVAVRSEELSGTRYAVYTLTVESDLWPMRRDRNLRIFQSQTVPQIVQTLLKEYGVNVEMRLSGSYRVW
EYCVQYQESSLDFISRLMELEGIYYWFRHEQERHTLVLCDATDQHKAFPGYETMTYHVTPSGGSVTEEGI
SQWSQAESVTPGMYSTDDYDFRKPNAWMLQARQNPASPTPGSVDVYDWPGHFVDHSHGEFYTRIRQEVWQ
VEHHSVSGSGTATGIAPGFTFGLLNAPHFSDNGEYLVTSATYVFEENSYASGDSGGSKHNIAFTVLPASV
TFRAEPTTAWPKTHGPQTAKVVGPQGESIWTDRYGRVKVKFHWDRLAKGDDSSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLIIGRVYNEASMPPWSLPAAATQMGFMSRSKDGTADTANALRFEDKSG
EEQVWLQAQKNMDTHVKNDETHSTDSNRTKTIGGNETTKVKKNRTETVDQNETLTIHQNRTETVDGNETI
TVHSNRTETVDQNESVRIGQNQSVSVNGNQTLKVAQAKTETIVLASMLNVGLAQNTNIGAAYVLNVGAGW
MTTVGAMHMHNVGRKYSLNVGRDIALSAGTSAEISAENKITLACGESKIVLEKNGTITLSANNIKLVGEK
VIDIDGTQIDIN
 
Nucleotide Sequence: 2139 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2595301-2593163 Pectobacterium sp. SCC3193, complete genome
ATGTTCTCACGCATCACCGCGCAGTTGCCGATGAACGGTCTGCTGTTCTGGAAACTCTCGGGCACCGAGA
CGTTGTCCCACTCATTTGTGCTGACCGCCGACCTGCTTGCCACCGGCGCACGGATTGACCGACATGCGCT
GCTGGGCCAGCCGGTCACGTTCACACTGCCGACGCAGAGCCTGCTGAGCTCGCGCTACCTCAACGGCAAA
ATCACTCGGGTCGCGGTGCGCAGCGAAGAGCTGAGCGGCACGCGCTACGCGGTCTACACGCTGACGGTGG
AATCGGACCTGTGGCCGATGCGGCGTGACCGCAATCTGCGCATCTTCCAGAGTCAGACGGTGCCGCAGAT
AGTGCAGACGCTGCTGAAAGAGTACGGGGTGAATGTGGAGATGCGTTTATCGGGCAGCTACCGGGTGTGG
GAGTACTGCGTGCAGTATCAGGAGAGCAGCCTGGACTTTATCAGCCGACTGATGGAGTTGGAGGGGATTT
ACTACTGGTTCCGCCACGAGCAGGAGCGCCACACGCTGGTGCTGTGCGACGCGACAGACCAGCACAAGGC
ATTTCCCGGCTACGAGACGATGACATATCACGTGACGCCGTCGGGTGGCAGCGTGACGGAAGAGGGCATC
AGCCAGTGGTCGCAGGCAGAGAGCGTCACGCCAGGGATGTACAGCACGGACGATTACGATTTTCGCAAGC
CAAACGCGTGGATGCTTCAGGCGCGGCAGAATCCGGCGTCGCCGACGCCGGGCTCGGTGGACGTGTACGA
CTGGCCGGGTCATTTTGTGGACCACAGCCACGGCGAGTTTTACACGCGTATCCGTCAGGAGGTGTGGCAG
GTAGAGCACCACAGCGTGAGCGGGTCGGGCACAGCGACGGGCATTGCACCGGGGTTTACCTTCGGCCTTC
TTAACGCGCCGCATTTTAGCGACAACGGTGAGTATCTGGTGACATCGGCGACGTATGTGTTTGAGGAAAA
CAGCTACGCCAGCGGTGATAGCGGAGGCTCGAAGCACAACATTGCGTTCACGGTGCTGCCTGCGTCGGTA
ACGTTCCGGGCGGAGCCGACGACGGCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGGTGGTGGGCC
CGCAGGGAGAATCTATCTGGACGGACCGGTACGGCCGGGTGAAGGTAAAGTTCCACTGGGACCGACTGGC
GAAGGGCGACGACAGCAGCTCGTGCTGGGTACGTGTATCGAGCGCCTGGGCGGGTCAGGGATTTGGCGGG
GTGCAGATCCCGCGCGTGGGCGATGAAGTGGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TCATCGGCCGGGTGTACAACGAGGCGAGCATGCCGCCGTGGTCGCTGCCAGCGGCGGCGACGCAGATGGG
ATTTATGAGTCGGTCGAAAGACGGCACGGCGGATACGGCGAACGCGCTGCGCTTTGAGGACAAGTCGGGT
GAGGAGCAGGTGTGGCTGCAAGCTCAGAAAAACATGGATACGCATGTCAAGAATGACGAAACCCACTCGA
CTGACAGCAATCGCACTAAAACCATTGGTGGCAATGAAACGACCAAGGTGAAAAAAAACCGCACCGAGAC
GGTTGATCAAAATGAGACCCTCACCATCCATCAGAACCGAACCGAAACCGTGGACGGCAATGAAACTATC
ACCGTGCACAGCAACCGCACTGAGACGGTCGATCAGAACGAAAGCGTGCGTATTGGTCAGAATCAGTCAG
TCAGCGTAAACGGTAATCAGACGCTGAAGGTGGCTCAGGCGAAAACTGAAACTATCGTGCTGGCTTCCAT
GCTTAATGTGGGACTGGCGCAAAATACCAATATCGGTGCGGCCTATGTGCTCAACGTGGGCGCGGGTTGG
ATGACTACCGTGGGGGCGATGCATATGCACAACGTCGGCAGGAAATACTCCCTGAATGTCGGGCGCGATA
TCGCGCTTTCTGCTGGCACGTCGGCCGAGATCAGCGCGGAAAACAAGATTACGCTGGCATGTGGCGAGTC
GAAGATTGTGCTGGAAAAGAATGGCACCATCACCCTCAGCGCGAACAACATCAAGCTGGTAGGTGAGAAG
GTGATCGACATTGACGGAACGCAGATAGATATCAATTGA

Protein ID: 470154878
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2420
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2602263..2604026 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK4FJ42
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-76, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 2.70E-25, Aligned region: 365..458
Protein Sequence: 587 a.a.     [Download]
>gi|470154878|ref|YP_006283380.1| Rhs element Vgr protein [Pectobacterium sp. SCC3193]
MFSRITAQLPMDGLLFWKLSGTETLSHSFVLTADLLATDARIDRHALLGQPVTFTLPTQSLLSPRYLNGK
ITRVAVRSEELSGTRYAVYTLTVESDLWPMRRDRNLRIFQSQTVPQIVQTLLKEYGVNVEIRLSGSYRVW
EYCVQYQESSLDFLSRLMELEGIYYWFRHEQERHTLVLCDATDQHKAFPGYETMTYHATPSGGSVTEEGI
SQWSLAESVTPGMYSTDDYDFRKPNAWMLQARQNPASPTPGSVDVYDWPGHFVDHSHGEFYTRIRQEVWQ
VEHHSVSGSGTVTGIAPGFTFGLLNAPHFSDNGEYLVTSATYVFEENSYASGDSGGSKHNIAFTVLPASV
TFRAEPTTAWPKTHGPQTAKVVGPQGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLIIGRVYNEASMPPWNLPEDATRMGFMSRSKDGHHDNSSFLFFEDKSG
DELLNMHAEKDMSVSVENDKTIAIEGCRTTTIGKEQSDKVTGDATFHYKQKRTTTVDDAEINTFNNGEFT
TIKNGRTLKITSGGDEISINGDKKNSN
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2604026-2602263 Pectobacterium sp. SCC3193, complete genome
ATGTTCTCACGCATCACCGCGCAGTTGCCGATGGACGGCCTGCTGTTCTGGAAACTCTCGGGCACCGAGA
CGTTGTCCCACTCATTTGTGCTGACCGCCGATCTGCTTGCCACCGACGCACGCATCGATCGGCATGCGCT
GCTGGGCCAGCCGGTCACGTTCACACTGCCGACGCAGAGCCTGCTGAGCCCGCGCTACCTCAACGGCAAA
ATCACTCGGGTCGCGGTGCGCAGCGAAGAGCTGAGCGGCACGCGCTACGCGGTCTACACGCTGACGGTGG
AATCGGACCTGTGGCCGATGCGGCGTGACCGCAACCTGCGCATCTTCCAGAGTCAGACGGTGCCGCAGAT
AGTGCAGACGCTGCTGAAAGAGTACGGGGTAAATGTGGAGATACGTTTATCGGGCAGCTACCGGGTGTGG
GAGTACTGTGTGCAGTATCAGGAGAGCAGCCTGGATTTCCTCAGCCGACTGATGGAGCTAGAAGGGATTT
ACTACTGGTTCCGCCACGAGCAGGAGCGCCACACGCTGGTATTGTGCGACGCCACGGACCAGCACAAGGC
ATTTCCCGGCTACGAGACGATGACATATCACGCAACGCCGTCGGGTGGCAGCGTGACGGAAGAGGGCATC
AGCCAGTGGTCGCTGGCAGAGAGCGTCACGCCGGGAATGTACAGCACGGACGATTACGATTTTCGCAAGC
CAAACGCGTGGATGCTTCAGGCGCGGCAGAATCCGGCGTCGCCGACGCCGGGCTCGGTGGACGTGTACGA
CTGGCCGGGTCATTTTGTGGACCACAGCCACGGCGAGTTTTACACGCGTATCCGTCAGGAGGTGTGGCAG
GTAGAGCACCACAGCGTGAGCGGGTCGGGTACGGTGACGGGCATTGCACCGGGGTTTACCTTCGGCCTTC
TTAACGCGCCGCATTTTAGCGACAACGGTGAGTATCTGGTGACATCGGCGACGTATGTGTTTGAGGAAAA
CAGCTACGCCAGCGGTGATAGCGGAGGCTCGAAACACAACATTGCGTTCACGGTGCTGCCTGCGTCGGTA
ACGTTCCGGGCGGAGCCGACGACAGCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGGTGGTGGGCC
CGCAGGGAGAATCTATCTGGACGGACCGGTACGGCCGGGTGAAGGTAAAGTTCCACTGGGATCGACTGGC
GAAGGGCGACGACACCAGCTCGTGCTGGGTACGTGTATCGAGCGCCTGGGCGGGTCAGGGATTTGGCGGG
GTGCAGATCCCGCGCGTGGGCGATGAAGTAGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TCATCGGCCGGGTGTACAACGAGGCGAGCATGCCGCCGTGGAATCTCCCCGAGGATGCGACACGTATGGG
TTTTATGAGCCGCAGCAAAGACGGGCATCATGACAACTCCAGCTTCCTGTTTTTTGAGGATAAGTCGGGG
GATGAACTGCTCAATATGCATGCTGAGAAGGACATGAGCGTCTCAGTGGAGAATGACAAGACCATCGCCA
TTGAAGGTTGCCGCACGACCACTATCGGCAAAGAACAGAGCGATAAAGTAACCGGTGATGCCACATTCCA
TTACAAGCAAAAGCGGACGACAACAGTTGATGATGCTGAGATTAATACATTTAATAATGGTGAATTTACA
ACTATAAAAAATGGACGTACTTTAAAAATAACAAGCGGTGGAGACGAAATATCAATTAATGGTGATAAAA
AAAACTCGAATTAA