SecReT6
Protein ID: 470154878
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2420
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2602263..2604026 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDK4FJ42
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.20E-76, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 2.70E-25, Aligned region: 365..458
Protein Sequence: 587 a.a.     [Download]
>gi|470154878|ref|YP_006283380.1| Rhs element Vgr protein [Pectobacterium sp. SCC3193]
MFSRITAQLPMDGLLFWKLSGTETLSHSFVLTADLLATDARIDRHALLGQPVTFTLPTQSLLSPRYLNGK
ITRVAVRSEELSGTRYAVYTLTVESDLWPMRRDRNLRIFQSQTVPQIVQTLLKEYGVNVEIRLSGSYRVW
EYCVQYQESSLDFLSRLMELEGIYYWFRHEQERHTLVLCDATDQHKAFPGYETMTYHATPSGGSVTEEGI
SQWSLAESVTPGMYSTDDYDFRKPNAWMLQARQNPASPTPGSVDVYDWPGHFVDHSHGEFYTRIRQEVWQ
VEHHSVSGSGTVTGIAPGFTFGLLNAPHFSDNGEYLVTSATYVFEENSYASGDSGGSKHNIAFTVLPASV
TFRAEPTTAWPKTHGPQTAKVVGPQGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVVDFINGDPDRPLIIGRVYNEASMPPWNLPEDATRMGFMSRSKDGHHDNSSFLFFEDKSG
DELLNMHAEKDMSVSVENDKTIAIEGCRTTTIGKEQSDKVTGDATFHYKQKRTTTVDDAEINTFNNGEFT
TIKNGRTLKITSGGDEISINGDKKNSN
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2604026-2602263 Pectobacterium sp. SCC3193, complete genome
ATGTTCTCACGCATCACCGCGCAGTTGCCGATGGACGGCCTGCTGTTCTGGAAACTCTCGGGCACCGAGA
CGTTGTCCCACTCATTTGTGCTGACCGCCGATCTGCTTGCCACCGACGCACGCATCGATCGGCATGCGCT
GCTGGGCCAGCCGGTCACGTTCACACTGCCGACGCAGAGCCTGCTGAGCCCGCGCTACCTCAACGGCAAA
ATCACTCGGGTCGCGGTGCGCAGCGAAGAGCTGAGCGGCACGCGCTACGCGGTCTACACGCTGACGGTGG
AATCGGACCTGTGGCCGATGCGGCGTGACCGCAACCTGCGCATCTTCCAGAGTCAGACGGTGCCGCAGAT
AGTGCAGACGCTGCTGAAAGAGTACGGGGTAAATGTGGAGATACGTTTATCGGGCAGCTACCGGGTGTGG
GAGTACTGTGTGCAGTATCAGGAGAGCAGCCTGGATTTCCTCAGCCGACTGATGGAGCTAGAAGGGATTT
ACTACTGGTTCCGCCACGAGCAGGAGCGCCACACGCTGGTATTGTGCGACGCCACGGACCAGCACAAGGC
ATTTCCCGGCTACGAGACGATGACATATCACGCAACGCCGTCGGGTGGCAGCGTGACGGAAGAGGGCATC
AGCCAGTGGTCGCTGGCAGAGAGCGTCACGCCGGGAATGTACAGCACGGACGATTACGATTTTCGCAAGC
CAAACGCGTGGATGCTTCAGGCGCGGCAGAATCCGGCGTCGCCGACGCCGGGCTCGGTGGACGTGTACGA
CTGGCCGGGTCATTTTGTGGACCACAGCCACGGCGAGTTTTACACGCGTATCCGTCAGGAGGTGTGGCAG
GTAGAGCACCACAGCGTGAGCGGGTCGGGTACGGTGACGGGCATTGCACCGGGGTTTACCTTCGGCCTTC
TTAACGCGCCGCATTTTAGCGACAACGGTGAGTATCTGGTGACATCGGCGACGTATGTGTTTGAGGAAAA
CAGCTACGCCAGCGGTGATAGCGGAGGCTCGAAACACAACATTGCGTTCACGGTGCTGCCTGCGTCGGTA
ACGTTCCGGGCGGAGCCGACGACAGCGTGGCCGAAGACGCACGGCCCGCAGACGGCGAAGGTGGTGGGCC
CGCAGGGAGAATCTATCTGGACGGACCGGTACGGCCGGGTGAAGGTAAAGTTCCACTGGGATCGACTGGC
GAAGGGCGACGACACCAGCTCGTGCTGGGTACGTGTATCGAGCGCCTGGGCGGGTCAGGGATTTGGCGGG
GTGCAGATCCCGCGCGTGGGCGATGAAGTAGTGGTGGACTTCATCAACGGCGACCCGGACCGCCCGCTGA
TCATCGGCCGGGTGTACAACGAGGCGAGCATGCCGCCGTGGAATCTCCCCGAGGATGCGACACGTATGGG
TTTTATGAGCCGCAGCAAAGACGGGCATCATGACAACTCCAGCTTCCTGTTTTTTGAGGATAAGTCGGGG
GATGAACTGCTCAATATGCATGCTGAGAAGGACATGAGCGTCTCAGTGGAGAATGACAAGACCATCGCCA
TTGAAGGTTGCCGCACGACCACTATCGGCAAAGAACAGAGCGATAAAGTAACCGGTGATGCCACATTCCA
TTACAAGCAAAAGCGGACGACAACAGTTGATGATGCTGAGATTAATACATTTAATAATGGTGAATTTACA
ACTATAAAAAATGGACGTACTTTAAAAATAACAAGCGGTGGAGACGAAATATCAATTAATGGTGATAAAA
AAAACTCGAATTAA