SecReT6
Protein ID: 470154880
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2422
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2605504..2608113 [-]
ProductType VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDK4FVB1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 222..241
AAA_2 [PF07724], Evalue: 1.70E-39, Aligned region: 600..765
AAA [PF00004], Evalue: 3.30E-20, Aligned region: 123..161
AAA [PF00004], Evalue: 3.30E-20, Aligned region: 224..356
AAA [PF00004], Evalue: 3.30E-20, Aligned region: 374..392
AAA [PF00004], Evalue: 3.30E-20, Aligned region: 606..690
ClpB_D2-small [PF10431], Evalue: 1.30E-15, Aligned region: 773..848
AAA_5 [PF07728], Evalue: 6.10E-12, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 6.10E-12, Aligned region: 605..723
AAA_16 [PF13191], Evalue: 8.20E-10, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 8.20E-10, Aligned region: 201..244
AAA_16 [PF13191], Evalue: 8.20E-10, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 8.20E-10, Aligned region: 596..650
AAA_16 [PF13191], Evalue: 8.20E-10, Aligned region: 670..692
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 224..304
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 604..640
Sigma54_activat [PF00158], Evalue: 3.20E-07, Aligned region: 209..238
Sigma54_activat [PF00158], Evalue: 3.20E-07, Aligned region: 295..305
Sigma54_activat [PF00158], Evalue: 3.20E-07, Aligned region: 605..721
AAA_25 [PF13481], Evalue: 4.50E-06, Aligned region: 223..248
AAA_25 [PF13481], Evalue: 4.50E-06, Aligned region: 277..321
AAA_25 [PF13481], Evalue: 4.50E-06, Aligned region: 592..630
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 223..246
AAA_19 [PF13245], Evalue: 1.40E-05, Aligned region: 603..627
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 208..243
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 605..634
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 715..736
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 224..304
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 330..390
AAA_14 [PF13173], Evalue: 1.60E-05, Aligned region: 604..715
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 128..155
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 223..247
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 453..489
Zeta_toxin [PF06414], Evalue: 3.30E-05, Aligned region: 598..645
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 224..251
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 281..326
NACHT [PF05729], Evalue: 5.00E-05, Aligned region: 606..644
AAA_17 [PF13207], Evalue: 9.20E-05, Aligned region: 224..243
AAA_17 [PF13207], Evalue: 9.20E-05, Aligned region: 605..641
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 224..244
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 607..634
AAA_18 [PF13238], Evalue: 0.00029, Aligned region: 799..855
AAA_29 [PF13555], Evalue: 0.00066, Aligned region: 216..240
AAA_29 [PF13555], Evalue: 0.00066, Aligned region: 603..630
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 116..123
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 311..321
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 203..238
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 277..308
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 358..398
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 604..647
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 606..627
RNA_helicase [PF00910], Evalue: 0.0022, Aligned region: 703..724
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 222..241
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 280..304
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 572..626
RuvB_N [PF05496], Evalue: 0.0058, Aligned region: 674..698
SRP54 [PF00448], Evalue: 0.0067, Aligned region: 223..244
SRP54 [PF00448], Evalue: 0.0067, Aligned region: 604..636
DUF258 [PF03193], Evalue: 0.0092, Aligned region: 213..242
DUF258 [PF03193], Evalue: 0.0092, Aligned region: 604..625
Protein Sequence: 869 a.a.     [Download]
>gi|470154880|ref|YP_006283382.1| Type VI secretion ATPase, ClpV1 family [Pectobacterium sp. SCC3193]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQEGDLQRVISHFSLDENALTRD
IVAALDRLPRGASAVSDLAEHIDSAVERAWVYASLKYGATRIRGGHLLIGMLKTFNLANVLKGISSQFAH
INADALLEQFDTVLGSSKEAQQALITPPGVDGAAPIASDSTLAQYAQDLTARAREGHIDPVTGRDEEIRQ
MVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIATGAVPAPLRDVQLWLLDIGILQAGAGMKGEFEARL
QALINEVQSSPTPIVLFVDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPAL
TRRFQTVQIQEPDEDKAILMLRGTVSALEKHHQVLLLDEAVSAAVKLSHRYIPARQLPDKAVALLDTACA
RVAVSQSAQPAALEDCLHRLNALEIEAEITARETKVGLGDAGRQQAIAAQRTELEAERDALQQRWQKERE
LVNQLIALCGRCVVEGEAALRDELGIARQRLREVQSETPLLFAAVDAGVVAAVVSDWTGIPLGRMVKNEI
DAVLNLADTLNQRVIGQRHGLDLIAKRVRTARARLDNPNKPVGVFMLCGPSGVGKTETALALAESLYGGE
QNVITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDK
GWMEDGEGRHIDFRNTIIILTSNVGTQVISALCADPELMPDPDSLSAALRKPLLEVFPAALLGRLLVVPY
YPLSDAMLAKIVQLQLARIVRRLADNHGIETEIDASVVHLIVQRCTEVESGGRMVDAILTNTLLPQMSQM
LLSAHARDEHYRRIYVRCEQGEFVCQFDI
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2608113-2605504 Pectobacterium sp. SCC3193, complete genome
ATGTCAGAAATCAGCCGTGCCGTGTTATTCGGCAAGCTAGATACGTTGTTATTTACCTCGCTGGAAAGCG
CCACCGCCTTTTGTAAACTGCGCGGTAATCCCTATGTTGAACTGGTGCATTGGCTGCATCAGTTGATGCA
GCAACAAGAGGGTGACTTGCAGCGGGTCATCAGCCATTTTTCGCTGGATGAAAACGCACTGACGCGAGAT
ATCGTTGCTGCCCTTGACCGCCTGCCACGTGGAGCGAGTGCAGTCTCCGACCTCGCTGAACACATTGATA
GTGCTGTGGAGCGCGCCTGGGTTTACGCCTCGCTTAAGTATGGTGCCACACGGATCCGTGGTGGCCATCT
ACTGATCGGCATGCTGAAAACCTTCAATCTCGCCAACGTGCTGAAAGGCATTTCCAGCCAGTTTGCCCAT
ATTAACGCCGATGCGCTGTTGGAGCAGTTCGATACGGTACTCGGCAGCAGCAAAGAAGCGCAGCAGGCGC
TAATCACACCGCCGGGCGTAGACGGTGCCGCCCCGATAGCCAGCGATAGCACGCTGGCACAGTACGCACA
GGATCTCACCGCGCGGGCGCGTGAAGGGCATATTGATCCGGTCACCGGACGAGACGAAGAGATTCGCCAG
ATGGTGGATATTCTGATGCGTCGCCGCCAGAACAATCCGCTGCTGACCGGTGAGGCTGGCGTCGGTAAAA
CGGCGGTAGTAGAAGGACTGGCGCTACGGATTGCTACAGGCGCTGTGCCAGCACCGTTGCGCGATGTGCA
GTTGTGGCTGCTGGATATCGGCATACTACAGGCCGGTGCTGGGATGAAAGGTGAATTCGAAGCGCGTTTA
CAGGCACTAATCAATGAAGTGCAGTCCAGTCCAACGCCCATTGTGCTGTTTGTTGATGAGATCCACACGC
TGGTCGGCGCGGGTGGACAGCAGGGCACGGGCGATGCCGCTAACCTGCTTAAACCGGCGTTGGCGCGCGG
TCAGTTACGCACTATCGGCGCGACCACATGGGCTGAATACAAAAAATATATCGAGAAAGATCCTGCACTG
ACACGCCGCTTCCAGACTGTACAGATACAGGAACCGGATGAAGACAAAGCGATTCTGATGTTGCGCGGTA
CTGTTAGCGCACTGGAAAAGCATCATCAGGTGCTGCTGCTGGATGAAGCGGTCAGTGCGGCGGTGAAACT
GTCGCATCGCTATATTCCCGCACGGCAGTTGCCAGACAAAGCCGTTGCCCTGCTTGATACCGCTTGCGCG
CGGGTGGCGGTAAGCCAGAGCGCGCAGCCTGCGGCACTGGAAGATTGTTTGCATCGCTTGAATGCACTGG
AGATTGAAGCAGAAATTACCGCGCGTGAAACCAAAGTCGGCCTTGGTGACGCTGGGCGGCAGCAGGCGAT
TGCCGCCCAGCGCACGGAACTGGAAGCCGAACGTGATGCGTTGCAGCAGCGTTGGCAGAAGGAACGCGAG
CTGGTTAATCAACTGATTGCGTTGTGTGGGCGTTGCGTGGTGGAAGGTGAAGCGGCATTGCGTGACGAAT
TGGGTATCGCTCGGCAGCGCTTGCGCGAGGTACAGAGCGAAACACCGCTGCTGTTCGCGGCGGTTGATGC
TGGCGTGGTTGCGGCGGTTGTGTCTGACTGGACCGGCATTCCTCTGGGTCGTATGGTAAAGAACGAGATT
GATGCAGTACTCAACCTTGCTGACACCCTGAATCAACGCGTGATTGGTCAGCGTCACGGCCTGGATTTGA
TCGCCAAACGTGTGCGCACCGCGCGCGCGCGCCTCGACAACCCTAACAAACCGGTCGGCGTGTTTATGCT
GTGCGGTCCGTCGGGCGTCGGCAAAACGGAAACGGCGTTGGCTCTGGCGGAGTCACTGTATGGTGGTGAG
CAGAACGTCATCACCATCAACATGAGCGAATTTCAGGAATCGCACACCGTTTCCACGTTGAAAGGTGCGC
CTCCGGGCTACGTGGGTTACGGCGAGGGGGGTGTGCTGACCGAAGCCGTGCGTCGTCGTCCATACAGCGT
AGTCTTGCTGGATGAGATTGAGAAAGCGCATCCAGACGTACATGAACTTTTCTTTCAGGTGTTCGACAAA
GGCTGGATGGAGGATGGCGAAGGTCGGCATATCGATTTCCGTAACACCATCATCATTCTAACCTCCAATG
TCGGTACGCAGGTAATTAGTGCGTTGTGCGCCGATCCGGAACTGATGCCTGACCCTGATTCGCTCAGTGC
CGCGCTGCGTAAACCGTTGTTGGAGGTGTTCCCGGCCGCGCTGCTGGGGCGTTTATTGGTCGTGCCATAT
TACCCGCTGAGCGATGCCATGCTGGCGAAGATTGTGCAGTTACAACTGGCACGCATTGTTCGCCGTTTGG
CGGACAACCACGGCATTGAGACTGAGATCGATGCCTCCGTGGTACACCTGATCGTACAGCGCTGCACCGA
AGTTGAATCCGGTGGCCGTATGGTCGATGCCATCCTCACCAATACCCTGTTGCCGCAAATGAGCCAGATG
TTGCTCAGCGCCCATGCCCGCGATGAACACTATCGCCGTATATATGTGCGCTGTGAACAGGGCGAATTTG
TTTGCCAATTCGATATCTAA