SecReT6
Protein ID: 470154881
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2423
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2608169..2609218 [-]
ProductType VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDK4FNY7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-106, Aligned region: 26..330
Protein Sequence: 349 a.a.     [Download]
>gi|470154881|ref|YP_006283383.1| Type VI secretion protein, VC_A0111 family [Pectobacterium sp. SCC3193]
MSESAQVIALQRATRLPDNFWQGVMAAPWRYDLFQLLRKLDAQCGQGYALGRAPLPKFEAVRIGQTPSLA
FAPAAVAEVSRREEDDRHEISIYSFGLFGPNGPLPTHLTEYVRERIVHHQDHSFAAFADLFHHRATLLFY
RAWADAQPTVSLDRSDDCRFLNYLACLSGIGLPAQQQATSLSLHARLMLVGHLSRHGHDAEGLVRILRHY
FGVPVQMEQNVPQWLALDKRDRARLGAGRQMPRLGASSFLGISVRDVQHRFRLRFGPLNIEQYAHFLPDA
PGAREVRDWVRHYLGIEMQWDLSLILAADDVQSVTLSGNARLGYTSWLGQMPQLQDREDFMFEVEAAAR
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2609218-2608169 Pectobacterium sp. SCC3193, complete genome
ATGAGTGAGTCGGCGCAAGTGATTGCGCTGCAGCGGGCTACACGTCTACCGGATAATTTCTGGCAGGGGG
TGATGGCAGCACCGTGGCGCTACGATCTCTTCCAGTTGCTGCGCAAGTTGGATGCGCAGTGTGGGCAGGG
TTATGCGTTGGGCCGTGCGCCATTGCCGAAATTTGAAGCGGTGCGGATTGGTCAAACGCCGTCGTTGGCT
TTTGCACCCGCCGCGGTAGCGGAGGTGAGCCGACGTGAGGAGGATGATCGCCATGAGATTTCCATTTATA
GCTTCGGCTTGTTTGGCCCTAATGGGCCACTCCCTACGCACCTGACCGAATATGTACGCGAGCGTATCGT
GCATCATCAGGACCACAGTTTCGCCGCCTTTGCTGATCTATTTCACCACCGCGCCACGTTGCTGTTTTAT
CGCGCCTGGGCCGATGCACAGCCCACGGTGTCTCTGGATCGCAGCGATGACTGCCGGTTTCTCAACTATC
TGGCGTGTTTGTCCGGTATTGGATTACCCGCTCAGCAGCAGGCCACTTCACTGAGTTTGCATGCGCGTCT
GATGTTGGTCGGCCACCTCAGCCGTCACGGTCACGATGCTGAAGGACTGGTGCGTATTTTGCGCCACTAC
TTTGGCGTGCCGGTACAGATGGAACAGAACGTACCGCAATGGCTGGCGCTGGATAAGCGCGATCGGGCGC
GATTAGGGGCGGGCCGTCAGATGCCGCGCCTTGGCGCATCGTCATTTCTCGGTATTTCGGTGCGTGATGT
GCAGCACCGTTTTCGCCTGCGCTTTGGCCCGCTCAATATTGAACAGTATGCACACTTCCTGCCGGATGCG
CCGGGCGCACGCGAAGTGCGTGACTGGGTGCGCCACTACCTCGGCATTGAAATGCAGTGGGATCTCAGCC
TGATTTTGGCGGCTGATGACGTGCAGAGCGTGACGCTGAGCGGTAATGCTCGGCTCGGTTACACCAGTTG
GCTGGGGCAAATGCCACAGTTGCAGGATCGCGAGGATTTCATGTTTGAGGTTGAGGCAGCGGCACGCTAG