SecReT6
Protein ID: 470154882
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2424
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2609215..2611089 [-]
ProductType VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDK4FI13
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-206, Aligned region: 5..624
Protein Sequence: 624 a.a.     [Download]
>gi|470154882|ref|YP_006283384.1| Type VI secretion protein, VC_A0110 family [Pectobacterium sp. SCC3193]
MDSKLLDYYNRELAYLHEMGAEFAAHYPKVAGRLGMRGIDVADPYVERMLEGFAFLTSRVQLKMDAEFPR
FSQRMLEMIAPGYLSPTPSMAIAKLTPDTQKGDISNGFLVPRGTMMENQNLKKSGVTCSYTTAHDVMLQP
LCLSDVSLGGVPADIPLGELKLSGLGAASALRIRIECEGVPSLDQLKLDDVILYLSGPDIQALKLLELLM
QHRVGILLQSVEEKPLRRVLSDDALQQEGFAPEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLRQLAP
FIRCCGNARIFEIIILLDKADSALESVVDASHLALHCTPVINLFPKTAERLKISDSQHEYHLVVDNIRPL
DYEVHSVQRLFATVEGKREEQIFRSFWSTFSGDGSDYGAYFSLRREQRTLSEQAQRYGTRTGYIGSEVFL
SLVDEHHTPWRDDLRYLSADVMCTSRDLPLMLLQQDQGNFVMPDSIPVGPLTLCKGPTPPRPALAEGLSS
WRLISHLQMNYLSLMDCAGGEGAAALRQLLSLYANLADAPVSRQIEAIRHCQLSTVNRRVPEPGPVVFAR
GVSITLEVDEQAFSGASPWLFGSVLERVFSRLVALNSFTEFTLNSQQRGEVGYWPPRMGKKALI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2611089-2609215 Pectobacterium sp. SCC3193, complete genome
ATGGACAGCAAACTGCTCGATTACTACAACCGTGAGCTCGCTTATTTGCATGAAATGGGCGCGGAGTTTG
CTGCGCACTATCCCAAAGTGGCAGGGCGTCTGGGCATGCGAGGGATCGATGTCGCCGACCCTTACGTTGA
ACGAATGCTGGAAGGTTTTGCCTTCCTCACTTCGCGTGTTCAACTGAAAATGGACGCTGAATTTCCGCGT
TTTTCGCAGCGTATGCTGGAAATGATCGCGCCTGGTTACTTATCGCCAACGCCGTCAATGGCCATTGCCA
AACTGACGCCAGATACGCAAAAAGGCGACATCAGCAATGGTTTCCTCGTGCCACGCGGCACCATGATGGA
AAACCAAAATCTGAAAAAAAGCGGCGTCACCTGTAGCTACACCACGGCACATGACGTGATGCTGCAACCG
TTATGCCTCAGCGATGTCTCGCTCGGCGGTGTACCGGCTGATATCCCTTTGGGTGAACTAAAACTGAGCG
GCCTCGGTGCCGCCAGTGCATTGCGGATCCGTATTGAATGTGAAGGTGTTCCGTCGTTAGACCAGCTTAA
GCTGGATGATGTAATACTGTACCTGAGTGGCCCGGATATCCAGGCGCTGAAGCTGTTGGAATTATTGATG
CAGCATCGTGTCGGCATCCTGTTGCAATCCGTGGAAGAAAAGCCGCTGCGCCGGGTGTTAAGCGATGATG
CGCTACAGCAGGAAGGGTTTGCACCAGAGCAGGCGTTGCTGCCAGACGACCTGCGTAACTTCGATGGCTA
TCGCCTGTTGCAGGAGTATTTTGCTTTTCCTGCCCGTTTCCAGTTCATCAGTTTAAGGCAGTTAGCGCCG
TTCATTCGCTGCTGTGGCAACGCCCGAATCTTTGAAATTATTATCTTGCTGGATAAAGCCGACAGCGCAC
TAGAGAGTGTGGTGGATGCCAGTCATCTGGCATTACATTGCACCCCCGTCATTAATCTGTTCCCGAAAAC
CGCTGAACGTTTAAAGATCAGCGACAGCCAACACGAGTACCACTTGGTGGTCGATAATATCCGTCCACTG
GATTATGAAGTGCATTCGGTTCAGCGACTATTTGCCACGGTGGAAGGGAAACGAGAGGAGCAGATTTTCC
GCTCTTTCTGGAGCACCTTCAGTGGCGATGGAAGCGATTACGGTGCCTATTTTTCGCTGCGGCGCGAGCA
GCGCACGCTGTCCGAACAGGCGCAGCGCTATGGCACACGCACTGGCTACATCGGTTCGGAAGTTTTCCTG
TCGCTGGTCGATGAGCACCATACGCCGTGGCGTGATGACCTGCGTTATCTATCGGCAGACGTGATGTGTA
CCAGCCGTGATTTACCACTCATGCTATTACAGCAGGATCAGGGCAACTTCGTGATGCCAGATTCGATCCC
GGTGGGGCCGTTGACGTTGTGCAAAGGCCCAACGCCACCGCGTCCGGCGCTAGCAGAAGGCCTCTCATCC
TGGCGGCTGATTAGCCATCTGCAAATGAATTACCTCAGTCTGATGGACTGCGCCGGCGGTGAAGGCGCTG
CAGCATTGCGCCAGCTACTTAGCCTGTACGCCAACTTAGCCGATGCGCCAGTGTCACGCCAAATAGAAGC
CATCCGCCATTGCCAGCTCAGCACCGTCAACCGCCGTGTACCTGAACCGGGGCCCGTAGTGTTTGCACGG
GGTGTCAGTATCACGCTGGAGGTCGATGAACAGGCGTTTTCCGGTGCAAGCCCGTGGCTATTTGGCAGCG
TCTTGGAACGCGTTTTCTCTCGACTGGTTGCGCTAAACAGTTTCACTGAATTTACCCTGAACAGTCAGCA
GCGTGGCGAAGTCGGTTACTGGCCGCCTCGCATGGGCAAGAAGGCGTTGATATGA