SecReT6
Protein ID: 470154883
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2425
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2611092..2611667 [-]
ProductType VI secretion system lysozyme like protein
NoteTssE
UniProt IDK4FJ46
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.50E-20, Aligned region: 60..170
Protein Sequence: 191 a.a.     [Download]
>gi|470154883|ref|YP_006283385.1| Type VI secretion system lysozyme like protein [Pectobacterium sp. SCC3193]
MSSDNRSHNDGHAQLYGGFRARKNRDALTARDKLQSSLLDRLTDNAPDKRNEASSNTLISHSALRRHVLR
DLQWLFNTINNEAQQDLSEFGEVQRSVWNFGVAPLSGQNISDIEWQDIQRKMTDAILHFEPRILPQGLQV
RCVSDMTSLSLHNVLSIEIKGRLWCVPYPLEFLFRTQIELESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2611667-2611092 Pectobacterium sp. SCC3193, complete genome
ATGAGCAGTGATAACCGCTCGCACAACGACGGTCATGCACAGTTGTATGGCGGTTTCCGCGCACGTAAAA
ATCGCGATGCGTTAACCGCGCGCGACAAGCTGCAATCGTCGCTGCTCGATCGCCTGACCGATAATGCGCC
GGACAAACGTAACGAAGCCAGCAGCAACACGTTGATCTCGCACAGCGCACTGCGTCGGCATGTGCTGCGA
GACCTGCAGTGGCTGTTCAACACCATCAACAATGAGGCGCAGCAGGATCTCAGCGAATTCGGCGAAGTGC
AGCGTTCGGTGTGGAATTTCGGTGTGGCACCGCTGTCCGGGCAGAACATCTCAGACATCGAATGGCAGGA
TATACAGCGCAAAATGACTGATGCCATCCTGCACTTTGAGCCGCGCATTCTGCCGCAGGGCTTGCAGGTG
CGCTGCGTCAGCGACATGACATCACTCAGCCTGCATAACGTGTTGTCGATTGAGATTAAGGGCCGCCTGT
GGTGCGTGCCTTATCCATTGGAGTTTTTGTTCCGTACCCAGATTGAGCTGGAGAGCGGTCATTTCGAACT
ACAGGATGCCGGTTAA