SecReT6
Protein ID: 470154884
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2426
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2611657..2612484 [-]
ProductVirulence protein SciE type
NoteTagJ
UniProt IDK4FIM8
KEGG IDpec:W5S_2426
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.20E-38, Aligned region: 143..266
Protein Sequence: 275 a.a.     [Download]
>gi|470154884|ref|YP_006283386.1| Virulence protein SciE type [Pectobacterium sp. SCC3193]
MESLQQRLTRGSLADNLAEIMRQIQAAPANADLRAAFVQLLCLAGNWTRAQTQLQSWLALTPLAQPTVTL
LQQAIAGEQQREAVLRGEAEPQLPGCAWRWCETLLAALRADITGDYVRGAEWRAEALDQADANPGQLQQQ
DETTNFAWLMDGDSRFGPVCEAITNGRYYWIPFAAIREMVFQAPTSVTDLIWRHTRVQLVDGSEQICQIP
VRYPLQQGTDERYLRASITEWQTLGKEGGQFIGNGQKVWLSDSAEFPLLTLQQITFNAIEADDEQ
 
Nucleotide Sequence: 828 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2612484-2611657 Pectobacterium sp. SCC3193, complete genome
ATGGAGTCGTTACAACAGCGTCTGACGAGAGGTTCATTGGCCGATAATCTTGCTGAGATCATGCGCCAGA
TTCAGGCCGCCCCGGCCAATGCCGATTTACGAGCCGCCTTTGTGCAACTGCTGTGTTTGGCTGGCAATTG
GACGCGCGCGCAAACTCAACTGCAATCTTGGCTCGCCTTAACGCCACTGGCGCAGCCCACGGTAACCTTA
CTGCAGCAGGCAATTGCCGGTGAACAACAGCGTGAAGCGGTGCTGCGCGGCGAGGCGGAACCGCAGTTGC
CGGGCTGCGCCTGGCGCTGGTGTGAAACCCTGCTGGCTGCACTGCGTGCTGATATCACGGGTGATTACGT
GCGCGGCGCTGAGTGGCGTGCCGAGGCGCTGGATCAGGCTGACGCCAATCCTGGTCAACTGCAACAGCAG
GATGAGACAACGAATTTCGCTTGGCTGATGGACGGCGACAGCCGTTTCGGTCCGGTATGCGAAGCCATCA
CCAACGGTCGTTATTACTGGATCCCGTTTGCCGCTATTCGCGAGATGGTGTTTCAGGCTCCAACCAGCGT
CACCGACCTCATTTGGCGTCACACCCGCGTACAACTGGTGGATGGCAGCGAACAGATTTGCCAGATCCCA
GTGCGTTACCCCTTGCAGCAAGGTACGGATGAGCGCTATCTGCGCGCCAGCATTACCGAATGGCAGACGC
TGGGCAAAGAGGGTGGCCAGTTCATCGGCAACGGTCAGAAAGTGTGGCTGAGCGACAGTGCTGAATTCCC
GCTGCTGACGCTGCAACAGATCACCTTTAACGCGATCGAGGCTGACGATGAGCAGTGA