SecReT6
Protein ID: 470154890
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2432
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2617529..2618011 [-]
ProductType VI secretion system effector, Hcp1 family
NoteTssD
UniProt IDK4FVB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-36, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|470154890|ref|YP_006283392.1| Type VI secretion system effector, Hcp1 family [Pectobacterium sp. SCC3193]
MAIDMFLKVDGVTGESKDANHTGWTDINSFYWGANQPGNMSVGGGGGAGKVNFVDLSVNALIDKSTTAIL
KYCASGKHLSKIELSVCKAGGQQVEYARITLEDVLVTSVNYTGSDSGDTVGITYAFQASKVKQQYWEQTS
SGSKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2618011-2617529 Pectobacterium sp. SCC3193, complete genome
ATGGCTATTGATATGTTTTTAAAAGTTGATGGTGTGACGGGTGAGTCTAAAGACGCTAACCACACCGGCT
GGACGGATATCAATTCCTTTTACTGGGGCGCTAACCAACCTGGTAATATGTCCGTAGGGGGGGGCGGCGG
GGCCGGTAAGGTTAATTTTGTCGACCTGAGTGTCAATGCGTTGATCGACAAATCAACTACCGCAATCCTT
AAATATTGCGCAAGTGGTAAGCACCTTTCCAAAATTGAACTTTCGGTTTGTAAAGCGGGCGGTCAACAAG
TGGAATATGCTCGTATCACTTTAGAAGATGTGCTCGTGACTTCCGTTAACTACACTGGCTCTGACAGTGG
TGATACTGTTGGCATTACCTATGCCTTCCAGGCCTCAAAAGTGAAACAGCAGTACTGGGAACAAACTTCA
TCCGGCAGTAAAGGTGCTGAAAGCAGTGCGGGATGGAATATCAAAGAGAATAAAGAGGCGTAA