SecReT6
Protein ID: 470154891
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2433
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2618320..2619819 [-]
ProductType VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDK4FNZ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-197, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|470154891|ref|YP_006283393.1| Type VI secretion protein, EvpB/VC_A0108 family [Pectobacterium sp. SCC3193]
MTQTSQPQQPQGETRFSQDEFSALLNKEFRPKSDQAREAVERAVKTLAQQALENAITVSSDAYRTIQALI
AEIDEKLSQQVNQIIHHDDFQTLESAWRGLNYLVNNTETDEMLKIRFMSISKKELGRSLKRFKGAGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGMMMPRFLARLPYGIRTNPVDNFDFEEQTDGSDHSNYAWSN
AAYAMAANINRSFKEYGWCTAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPTEYHDADASANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVTVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2619819-2618320 Pectobacterium sp. SCC3193, complete genome
ATGACCCAGACTTCACAACCGCAGCAACCGCAGGGCGAAACCCGTTTTAGTCAGGATGAGTTCAGCGCGC
TGCTGAACAAAGAGTTCCGTCCGAAGAGCGATCAGGCGCGTGAAGCAGTAGAGCGCGCGGTGAAAACGTT
GGCGCAGCAGGCATTGGAAAACGCCATTACCGTATCGAGTGATGCGTACCGCACCATTCAGGCGCTGATC
GCTGAGATCGATGAAAAGCTGTCGCAGCAGGTGAATCAGATCATTCACCACGATGATTTTCAGACGCTGG
AAAGCGCGTGGCGCGGTCTGAATTATCTGGTGAACAACACCGAAACTGACGAGATGCTGAAAATTCGTTT
CATGAGCATCTCCAAGAAGGAGTTGGGCCGTAGCCTGAAACGTTTCAAAGGGGCGGGGTGGGATCAAAGC
CCGCTGTTCAAAAAAATCTACGAGCAGGAGTATGGTCAGTTCGGTGGTGAACCGTTTGGCTGTCTGGTGG
GCGATTATTACTTCGACCACAGCCCACAGGATGTCGAACTGCTGGGTGAAATGGCACGCATCGGTGCGGC
CGCACACTGTCCGTTCATCACCGGTACTGCACCGGGTGTGATGCAGATGGAATCCTGGCAGGAACTGGCT
AACCCACGCGATCTGACCAAGATTTTCCAAAACACCGAATATGCTGCATGGCGTAGCCTGCGTGAATCGG
AAGATGCCCGCTACCTCGGTATGATGATGCCGCGTTTCCTCGCGCGTCTGCCTTACGGTATTCGCACCAA
TCCGGTTGATAACTTTGATTTTGAAGAGCAGACCGACGGCTCTGACCACAGCAATTATGCATGGAGCAAT
GCGGCTTACGCGATGGCAGCCAACATCAACCGCTCGTTTAAAGAATACGGCTGGTGTACCGCGATTCGCG
GCGTGGAATCGGGTGGCGCAGTCGAAAACCTGCCGTGCCACACTTTCCCAAGTGATGACGGTGGCGTGGA
TATGAAGTGTCCGACCGAAATCGCCATCAGCGACAGACGCGAAGCCGAGTTGGCGAAAAACGGCTTTATG
CCGCTGGTGCATCGTAAAAACTCTGACTTTGCCGCCTTTATCGGTGCACAGTCGCTGCAGAAGCCAACCG
AGTATCACGATGCTGATGCCAGCGCCAACGCCCGCCTGGCCGCCCGTTTGCCCTATCTGTTCGCCTGCTG
CCGCTTCGCGCATTACCTGAAATGCATTGTGCGCGACAAGATCGGTTCTTTCCGCGAGCGTGATGAAATG
GAGCGCTGGTTGAACGATTGGGTAATGAACTACGTTGATGGCGATCCTGCTAACTCCTCGCAGGAAACCA
AATCGCGTAAACCACTGGCCGCAGCCGAGGTAACCGTAGAGGAGCAGGAAGATAATCCAGGCTATTACGC
AGCGAAATTCTTCCTGCGCCCGCATTATCAGCTAGAAGGCCTGACGGTTTCGCTGCGCCTAGTATCGAAA
CTGCCATCGCTGAAATCGAATGAAAATTGA