SecReT6
Protein ID: 470154892
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2434
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2619819..2620349 [-]
ProductType VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDK4FI21
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.40E-59, Aligned region: 12..163
Protein Sequence: 176 a.a.     [Download]
>gi|470154892|ref|YP_006283394.1| Type VI secretion protein, VC_A0107 family [Pectobacterium sp. SCC3193]
MASTKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLVGKPLEPQVALDERKFLEIDIDN
FDERMKALKPRAAFQVDNTLNGEGKLNIDLTFESMDDFSPDAIARNVEPLSKLLDARTQLANLLTYMDGK
NGAEELVGKILQDPTLLQALTHLPKQDDAAEGKEDQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2620349-2619819 Pectobacterium sp. SCC3193, complete genome
ATGGCATCAACGAAATCCAGTGGGCAAAAGTTCATTGCCCGCAATCGCGCACCTCGCGTTCAGATCGAAT
ATGACGTGGAAATTTATGGCGCGGAACGCAAAATTCAGTTGCCGTTCGTCATGGGGGTATTGGCGGATCT
GGTGGGCAAACCGCTGGAGCCGCAGGTGGCCCTCGATGAACGTAAATTCCTCGAAATCGACATCGATAAC
TTTGATGAGCGCATGAAAGCGTTGAAGCCGCGCGCTGCCTTTCAGGTGGATAACACGTTGAACGGCGAAG
GTAAATTGAACATCGACCTGACTTTCGAAAGCATGGACGACTTCTCGCCTGACGCCATCGCGCGCAACGT
TGAGCCGCTGAGCAAGCTGTTGGATGCACGTACCCAGTTGGCTAACCTACTGACCTATATGGACGGTAAA
AACGGTGCGGAAGAACTGGTCGGTAAAATTTTGCAAGACCCCACGCTGCTGCAGGCGTTGACGCATCTGC
CGAAGCAGGACGATGCCGCTGAAGGTAAGGAAGATCAATAA