SecReT6
Protein ID: 470154893
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2435
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2620429..2621448 [-]
ProductType VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDK4FJ55
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.30E-18, Aligned region: 54..113
Protein Sequence: 339 a.a.     [Download]
>gi|470154893|ref|YP_006283395.1| Type VI secretion-associated protein, ImpA family [Pectobacterium sp. SCC3193]
MTINVDALLAPVSRDNPCGDNLEYHADFQAMEQASTGKAEQQFGNTIIPAEPADWNKVEKLAIDLLSRSK
DLRVILALTHAWTELKGLPGYAQGLKLIEQALLLYWEPLWPRLNEFSEEDPFYRINAVALLGDKSALSGA
VRQSWLLRYASDGITLRDAVALCDGSKTDVAEYPGGLPRLTDELARGEQPGTEAVLQIAGYLQTISETLA
ERLGESAVPELVQLRKQIAIIAERCQATDLNALRPKVTTAQPAETVAPVALTPMRVTADWRSLPLNSRAD
AQLMLEKVKQYFTQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQMENIFGRRD
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2621448-2620429 Pectobacterium sp. SCC3193, complete genome
ATGACGATAAATGTAGATGCCTTGCTGGCACCGGTTAGCCGTGACAATCCCTGCGGCGACAACCTGGAGT
ATCACGCGGATTTTCAGGCGATGGAACAGGCTAGCACGGGCAAAGCCGAGCAGCAGTTCGGTAACACCAT
TATCCCGGCGGAACCGGCGGACTGGAATAAAGTTGAAAAGCTGGCGATTGACTTACTGAGTCGCAGTAAA
GACCTGCGCGTGATATTAGCGCTGACGCATGCATGGACCGAATTGAAAGGCCTGCCGGGTTACGCTCAAG
GGTTGAAACTGATTGAGCAGGCCCTGCTGCTGTACTGGGAGCCACTGTGGCCGCGTCTGAACGAGTTCAG
CGAAGAAGATCCGTTTTATCGCATCAATGCTGTGGCGCTGCTGGGGGATAAATCGGCACTAAGCGGTGCG
GTGCGCCAGTCCTGGCTGCTGCGTTATGCCTCGGACGGCATCACGCTGCGCGATGCCGTGGCGCTATGTG
ATGGTAGCAAAACGGACGTTGCCGAGTATCCCGGCGGTTTGCCACGCCTGACTGATGAACTGGCGCGCGG
CGAACAGCCCGGCACAGAAGCGGTTCTGCAAATAGCGGGATATTTACAAACTATTAGTGAAACCCTTGCT
GAGCGCTTGGGTGAATCGGCGGTACCAGAGTTGGTACAACTGCGTAAACAGATTGCGATAATCGCCGAAC
GTTGTCAGGCCACCGATCTCAACGCCCTACGGCCCAAGGTTACCACTGCACAACCCGCCGAAACTGTCGC
ACCGGTTGCACTTACCCCGATGCGTGTTACCGCTGACTGGCGTAGTTTACCGCTCAATTCACGTGCCGAT
GCGCAACTGATGCTGGAGAAAGTGAAGCAGTATTTCACTCAGCATGAGCCAAGCCATCCGGCTCCGCTGA
TGATTGACCGCGTGCAGCGTCTGATCGAACTCGACTTTATGGACATTATCCGCGATCTCGCGCCGGATGG
TGTGCATCAGATGGAAAACATTTTTGGACGCCGCGACTAA