SecReT6
Protein ID: 470154896
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2438
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2625804..2627045 [-]
ProductType IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDK4FNZ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-70, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 4.60E-70, Aligned region: 362..390
OmpA [PF00691], Evalue: 4.60E-15, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|470154896|ref|YP_006283398.1| Type IV / VI secretion system protein, DotU family [Pectobacterium sp. SCC3193]
MMQEQQKPNHDATQQDINHQNMLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQVRLFELNCQQSGLS
YEVIVGARYCLCTALDEAAALTPWGSRGVWTSNSLLVTFHNETWGGEKFFQLLAKLSQSPRQHILLLELI
YFCLLLGFEGRYRVLDNGRSQLETIKQRLLQMIKSVRGSYFAALSPHPTDQPVLRKRWRPMIPLWACAAV
AGFAACLFYIGLNWRLGDYTSPVLASIYQTTLPEVKIRNPAPPPPASLNLKSFLKPEIDAGLVAVRDEAD
QSVVTLKGDGLFASASTDVRGRYDVVIKRVAEAMNNVRGKVLVIGYSDNVPIRSARFASNYELSLARAQS
VQTLLQQQLTQPSRVTAAGRGENHPLVPNTNAENRARNRRVEITLLVAPDATQAELNGLARGE
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2627045-2625804 Pectobacterium sp. SCC3193, complete genome
ATGATGCAGGAACAACAGAAACCGAACCATGATGCCACGCAGCAGGATATCAACCACCAGAATATGTTGG
TGGCGGCTGCCAACCCGCTGATTAACGCTATTCCTCAGATTCGACACTCCGTCTCCCATGACGATCCGGC
ACGCCTACGCCAGCAACTGATCGACCAGGTTCGACTCTTCGAGCTGAACTGCCAGCAGTCTGGCCTGAGT
TACGAAGTGATTGTTGGTGCCCGTTATTGTCTATGCACCGCGCTGGATGAAGCCGCTGCGCTGACGCCGT
GGGGTAGCCGTGGAGTGTGGACCAGTAACAGCCTGCTGGTGACATTTCACAATGAAACCTGGGGGGGCGA
GAAGTTTTTCCAACTACTGGCGAAGCTGTCACAGAGTCCGCGTCAGCACATTCTGCTGCTGGAGCTGATC
TACTTCTGCCTGCTGCTGGGCTTTGAAGGGCGCTACCGCGTGTTGGATAATGGCCGTTCACAGTTGGAAA
CCATCAAGCAGCGTCTGCTGCAGATGATCAAAAGCGTGCGCGGCAGTTACTTTGCGGCACTCTCTCCCCA
TCCGACCGATCAGCCGGTGCTACGTAAGCGGTGGCGTCCAATGATCCCGTTGTGGGCCTGCGCTGCCGTT
GCCGGTTTTGCTGCCTGCTTGTTCTATATTGGCCTTAACTGGCGTCTCGGTGATTACACCTCGCCAGTGC
TGGCCAGCATCTATCAGACGACGCTGCCGGAAGTGAAAATCCGCAATCCTGCACCACCTCCGCCTGCCTC
GTTGAACCTGAAATCCTTCCTGAAACCGGAGATCGATGCCGGTCTGGTCGCGGTACGCGATGAAGCTGAC
CAAAGCGTGGTAACGCTGAAAGGCGATGGGCTATTTGCTTCGGCATCAACCGACGTGCGTGGACGCTACG
ATGTCGTGATTAAGCGCGTTGCGGAAGCGATGAACAACGTGCGCGGCAAGGTTTTGGTGATTGGTTACAG
CGATAACGTGCCTATTCGCAGCGCCCGTTTTGCCTCCAACTATGAACTCTCGCTGGCGCGTGCGCAGTCG
GTGCAAACCCTGTTGCAGCAGCAGTTGACGCAGCCGTCACGCGTTACAGCCGCAGGGCGTGGCGAAAACC
ACCCGCTGGTGCCGAATACCAACGCAGAGAATCGCGCTCGTAACCGCCGCGTAGAGATTACGCTGCTGGT
CGCGCCAGACGCGACGCAAGCGGAACTCAACGGCTTGGCGAGAGGGGAGTAA