SecReT6
Protein ID: 470154897
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2439
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2627065..2628405 [-]
ProductType VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDK4FI25
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.70E-146, Aligned region: 19..442
Protein Sequence: 446 a.a.     [Download]
>gi|470154897|ref|YP_006283399.1| Type VI secretion protein, VC_A0114 family [Pectobacterium sp. SCC3193]
MNRSEKVVWTEGMFLRPHHFQQSENYLHSTLRDWGQSQRAYTWGFFDLEFDEALLRQGKLALSAASGCLP
DGTFFSFSLPQHGPAPLELPANVDRANVVLAIPARRNGREAVVFQETQDSLARYLAWETEVEDDNAQAIG
AATVQFGKLRLRLMLEQDLTAEWTAMGVAQVIEKRSGNHLRLDTDYIPPMLALNGSRPLQSMLNDLHGLM
QQRSQQLSQRAQGTGRFNSADMVDFMLLAMLNRQLGLHAHLQHLPLLHPETLYRYWLQLAAELCTWMPAR
TPEPLPLYNHDDLHGCFTRLTLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPESSMVREFGFVLAVKA
SVPAEALKTHFPAQMKVAPVTKIRDLVQLQLPGLVLKAMPGAPPQIPWHAGYSYFELDKNGELWKEMERS
GAFALHLAGEFPGLDMEFWAIRSSSE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2628405-2627065 Pectobacterium sp. SCC3193, complete genome
ATGAACAGATCCGAAAAGGTGGTTTGGACCGAAGGGATGTTCCTGCGTCCTCACCATTTCCAGCAGTCGG
AAAATTATCTTCACAGCACACTACGTGATTGGGGCCAGTCGCAACGCGCTTATACCTGGGGATTCTTCGA
TCTGGAGTTTGATGAAGCGCTGCTGCGTCAGGGAAAACTAGCGCTAAGTGCCGCCAGCGGTTGCCTGCCG
GATGGCACGTTCTTTTCCTTCAGCCTGCCGCAACATGGACCAGCACCGCTTGAACTGCCTGCCAATGTTG
ATCGTGCTAACGTGGTGCTGGCGATCCCAGCCCGCCGCAATGGTCGAGAAGCGGTGGTGTTTCAGGAGAC
ACAAGATTCTCTGGCTCGCTATCTCGCTTGGGAAACCGAAGTGGAAGATGACAACGCGCAGGCGATCGGC
GCGGCTACAGTACAGTTCGGTAAACTGCGTTTGCGTCTGATGCTGGAGCAAGATCTCACCGCAGAATGGA
CGGCAATGGGCGTAGCGCAGGTGATTGAGAAGCGCAGCGGTAACCACCTGCGCCTTGATACCGATTACAT
CCCACCGATGCTGGCGCTCAACGGCAGTCGGCCACTGCAAAGCATGCTTAACGATCTGCATGGTCTGATG
CAGCAGCGCAGTCAGCAACTAAGCCAGCGTGCGCAAGGTACTGGTCGCTTCAACAGTGCTGACATGGTCG
ATTTTATGCTACTGGCCATGCTGAATCGCCAACTCGGCCTGCATGCGCATCTGCAACATTTGCCGCTATT
GCATCCTGAAACGCTCTACCGCTATTGGTTGCAACTGGCTGCTGAACTCTGTACCTGGATGCCAGCACGC
ACGCCTGAACCCTTGCCGCTTTACAACCACGATGACCTGCACGGCTGTTTTACCCGTTTAACGCTGCTGC
TGCGTCAGGGGCTATCTCAGGTAATGGAAGAAAGTGCGATTCAGCTTCCACTCACCCAGCGCTCACACGG
TCTCAACGTTGCCACGGTGCCGGAAAGCAGCATGGTACGCGAATTCGGCTTTGTGCTGGCAGTAAAAGCC
AGTGTGCCTGCCGAAGCCCTGAAAACCCACTTCCCAGCACAAATGAAAGTCGCACCAGTTACCAAAATCC
GCGATCTGGTTCAACTGCAACTACCCGGCCTGGTGTTGAAAGCCATGCCGGGTGCACCGCCGCAAATTCC
ATGGCATGCCGGTTACAGCTACTTCGAGCTGGATAAGAACGGCGAGCTGTGGAAAGAGATGGAACGCTCC
GGTGCGTTTGCACTTCATCTAGCCGGTGAGTTTCCGGGCCTGGACATGGAGTTCTGGGCCATTCGTAGTT
CATCAGAATAA