SecReT6
Protein ID: 470154898
SecReT6 ID650
T6SS typei3
Gene symbol-
Locus tagW5S_2440
StrainPectobacterium sp. SCC3193
Repliconchromosome [GenBank: NC_017845] [Browse all T6SS(s) in this replicon]
Location [Strand]2628415..2628906 [-]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDK4FJ57
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.40E-26, Aligned region: 15..132
Protein Sequence: 163 a.a.     [Download]
>gi|470154898|ref|YP_006283400.1| Type VI secretion lipoprotein/VasD [Pectobacterium sp. SCC3193]
MTIMQLRCWLLPLLALLLIACSSSPTPVARYNLHFQAHPQINSGAPLKVRVMLLTSDAEFMSADFYSLQN
QPADALGSTLLNNQQFFLMSGQLSKMLNAKSLPEARYIGIMAEYQVLDGKVWRLALPFPDGENSAFWAFW
KSNDDELNAHMMADINGLRVVKQ
 
Nucleotide Sequence: 492 bp     [Download]
>gi|470152509|ref|NC_017845.1|:c2628906-2628415 Pectobacterium sp. SCC3193, complete genome
ATGACAATAATGCAACTGCGCTGCTGGCTGTTACCGCTACTGGCATTGCTACTGATTGCGTGCAGCAGCA
GTCCCACTCCGGTGGCGCGTTATAACTTGCACTTCCAGGCGCACCCGCAGATCAACAGCGGCGCACCGCT
CAAGGTGCGGGTGATGTTATTGACTTCAGACGCGGAATTCATGTCCGCCGACTTCTACTCCCTGCAGAAT
CAGCCCGCAGATGCATTGGGTAGCACGTTGCTCAACAACCAACAGTTTTTCCTGATGTCAGGTCAACTGA
GCAAAATGCTTAACGCCAAAAGTCTGCCAGAAGCGCGCTACATTGGCATCATGGCGGAGTATCAGGTGCT
GGACGGCAAAGTCTGGCGGCTGGCGCTACCGTTCCCAGATGGTGAGAACAGCGCGTTTTGGGCGTTCTGG
AAAAGTAACGACGATGAGTTGAACGCCCACATGATGGCGGACATCAACGGCCTTCGCGTGGTTAAGCAGT
AA