SecReT6
Protein ID: 470463470
SecReT6 ID739
T6SS typei4b
Gene symbol-
Locus tagETAC_11500
StrainEdwardsiella tarda C07-087
Repliconchromosome [GenBank: NC_020796] [Browse all T6SS(s) in this replicon]
Location [Strand]2607168..2607632 [+]
Producttype VI secretion system protein EvpA
NoteTssB
UniProt IDM4TMA8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-55, Aligned region: 2..146
Protein Sequence: 154 a.a.     [Download]
>gi|470463470|ref|YP_007629781.1| type VI secretion system protein EvpA [Edwardsiella tarda C07-087]
MQITYDVEIGDAQEMKELPFVMGVLGDYSGQPATPLPKLKERKFVSIDRDNFNDVIKGVHPHLSFRTENT
LSGDDSQLSVDLHFQSMADFTPERVAAQVEPLRKLMDIRSRLSDLKNKMYSNERLGEVLQGIIEDTEKLQ
SLGKETGFGEEKQP
 
Nucleotide Sequence: 465 bp     [Download]
>gi|470461182|ref|NC_020796.1|:2607168-2607632 Edwardsiella tarda C07-087, complete genome
GTGCAGATTACCTATGATGTTGAAATTGGCGATGCGCAGGAAATGAAGGAGCTGCCATTTGTTATGGGAG
TGCTCGGTGACTATTCAGGGCAGCCGGCGACTCCGCTTCCCAAGCTGAAAGAGCGCAAATTCGTTTCGAT
TGATCGCGACAACTTCAACGATGTGATCAAAGGGGTGCATCCCCATCTGTCATTCCGCACCGAGAATACC
CTGAGCGGAGATGACAGCCAGCTGTCGGTGGATCTGCATTTTCAGAGCATGGCGGATTTCACCCCAGAGC
GGGTCGCGGCGCAGGTTGAGCCGCTGCGCAAGCTGATGGATATCCGCAGCCGCCTCTCTGACCTGAAAAA
CAAGATGTACAGCAATGAACGCCTGGGTGAGGTATTGCAGGGCATCATTGAGGATACCGAAAAGCTGCAG
AGTCTGGGTAAAGAGACCGGCTTTGGCGAGGAGAAGCAGCCATGA